Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q8D6

Protein Details
Accession A0A0C3Q8D6   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-68PPQFQDRQVCRQRHRPRRWSTCMMPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 8, mito 5, cysk 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences MILGKMKETAEAYLGDKVTHAVVTVPAYFNDAQQPQPRQEGPPQFQDRQVCRQRHRPRRWSTCMMPSANRDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.15
4 0.14
5 0.13
6 0.11
7 0.09
8 0.06
9 0.07
10 0.09
11 0.1
12 0.1
13 0.09
14 0.12
15 0.12
16 0.12
17 0.15
18 0.14
19 0.16
20 0.21
21 0.23
22 0.22
23 0.25
24 0.26
25 0.24
26 0.3
27 0.35
28 0.33
29 0.4
30 0.44
31 0.42
32 0.46
33 0.5
34 0.48
35 0.5
36 0.56
37 0.54
38 0.54
39 0.64
40 0.7
41 0.74
42 0.81
43 0.81
44 0.84
45 0.86
46 0.89
47 0.87
48 0.83
49 0.81
50 0.78
51 0.72
52 0.66