Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LDE6

Protein Details
Accession A0A0C3LDE6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-124IDATAAKKKSQRKKCDKTTSRSYGVRHydrophilic
255-278LAGPIAKRCHRGRKKRGEVTIRIVHydrophilic
NLS Segment(s)
PositionSequence
264-270HRGRKKR
Subcellular Location(s) cyto 14, cyto_nucl 13.5, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR005522  IPK  
IPR038286  IPK_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0032958  P:inositol phosphate biosynthetic process  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF03770  IPK  
Amino Acid Sequences MGRPSQKTDAGLLFSGAGRPDSTSPKQSRNPSVGPGLFHPETGFPLERAVSQQGTASPPEPADASISRQEHFILLEDLTGRLKNPCVLDLKMGTRQYGIDATAAKKKSQRKKCDKTTSRSYGVRICGMQVWDNESQAYTTQNKYTGREIRSDEFQPVLGSFFRDGERLLVYHIPVVLQKLYGLARLIYRLKGYRFYGCSLLFIYDGDKETQEQYKGAVDAPSSRSKRGESLDRRRVDVHGKFRPTLRRTASEDLLAGPIAKRCHRGRKKRGEVTIRIVDFAHTTTGRDYARMDGRDDIPEEVRNPTDKGYRADIDPETGLLYARFPPHHPEKPDLGFLFGIMNLCKTLEGIYNEERTKRFKAAREGQSVEQLSPLSYNSKDIFSAIFETDDPSNDIDPGMLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.17
4 0.15
5 0.12
6 0.14
7 0.17
8 0.24
9 0.29
10 0.37
11 0.42
12 0.5
13 0.58
14 0.64
15 0.69
16 0.68
17 0.67
18 0.62
19 0.65
20 0.58
21 0.53
22 0.47
23 0.46
24 0.39
25 0.35
26 0.31
27 0.23
28 0.23
29 0.26
30 0.24
31 0.16
32 0.18
33 0.19
34 0.19
35 0.21
36 0.23
37 0.19
38 0.17
39 0.19
40 0.19
41 0.21
42 0.22
43 0.19
44 0.17
45 0.16
46 0.17
47 0.16
48 0.14
49 0.16
50 0.15
51 0.18
52 0.24
53 0.25
54 0.25
55 0.25
56 0.25
57 0.21
58 0.21
59 0.18
60 0.13
61 0.11
62 0.12
63 0.12
64 0.12
65 0.13
66 0.12
67 0.11
68 0.11
69 0.13
70 0.16
71 0.16
72 0.19
73 0.22
74 0.23
75 0.26
76 0.28
77 0.3
78 0.33
79 0.33
80 0.3
81 0.26
82 0.25
83 0.23
84 0.21
85 0.17
86 0.13
87 0.14
88 0.17
89 0.23
90 0.24
91 0.25
92 0.3
93 0.38
94 0.47
95 0.55
96 0.64
97 0.68
98 0.77
99 0.86
100 0.91
101 0.9
102 0.89
103 0.89
104 0.85
105 0.81
106 0.73
107 0.65
108 0.59
109 0.53
110 0.47
111 0.37
112 0.3
113 0.26
114 0.24
115 0.24
116 0.19
117 0.21
118 0.19
119 0.19
120 0.18
121 0.15
122 0.14
123 0.12
124 0.15
125 0.13
126 0.14
127 0.15
128 0.2
129 0.22
130 0.24
131 0.3
132 0.35
133 0.34
134 0.37
135 0.39
136 0.37
137 0.39
138 0.38
139 0.32
140 0.25
141 0.23
142 0.19
143 0.15
144 0.14
145 0.1
146 0.1
147 0.09
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.09
155 0.1
156 0.1
157 0.09
158 0.1
159 0.1
160 0.09
161 0.08
162 0.1
163 0.08
164 0.07
165 0.07
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.11
173 0.12
174 0.11
175 0.13
176 0.15
177 0.16
178 0.2
179 0.21
180 0.23
181 0.23
182 0.24
183 0.26
184 0.23
185 0.23
186 0.19
187 0.18
188 0.13
189 0.12
190 0.11
191 0.08
192 0.09
193 0.09
194 0.08
195 0.08
196 0.1
197 0.12
198 0.12
199 0.11
200 0.11
201 0.11
202 0.12
203 0.12
204 0.11
205 0.09
206 0.11
207 0.15
208 0.23
209 0.23
210 0.24
211 0.24
212 0.25
213 0.28
214 0.29
215 0.36
216 0.38
217 0.47
218 0.55
219 0.55
220 0.56
221 0.53
222 0.51
223 0.49
224 0.46
225 0.44
226 0.42
227 0.44
228 0.44
229 0.47
230 0.54
231 0.49
232 0.5
233 0.45
234 0.44
235 0.47
236 0.5
237 0.47
238 0.38
239 0.36
240 0.29
241 0.25
242 0.19
243 0.13
244 0.09
245 0.11
246 0.13
247 0.14
248 0.2
249 0.24
250 0.36
251 0.46
252 0.56
253 0.64
254 0.73
255 0.82
256 0.84
257 0.88
258 0.86
259 0.81
260 0.78
261 0.75
262 0.63
263 0.53
264 0.45
265 0.36
266 0.28
267 0.23
268 0.18
269 0.11
270 0.11
271 0.11
272 0.16
273 0.15
274 0.15
275 0.16
276 0.18
277 0.24
278 0.25
279 0.26
280 0.25
281 0.27
282 0.29
283 0.29
284 0.25
285 0.21
286 0.22
287 0.21
288 0.2
289 0.2
290 0.2
291 0.2
292 0.21
293 0.24
294 0.26
295 0.28
296 0.31
297 0.31
298 0.3
299 0.33
300 0.31
301 0.28
302 0.25
303 0.21
304 0.17
305 0.15
306 0.14
307 0.09
308 0.1
309 0.11
310 0.14
311 0.16
312 0.17
313 0.24
314 0.33
315 0.41
316 0.43
317 0.46
318 0.49
319 0.51
320 0.56
321 0.49
322 0.42
323 0.34
324 0.31
325 0.26
326 0.2
327 0.18
328 0.11
329 0.11
330 0.09
331 0.1
332 0.09
333 0.08
334 0.09
335 0.13
336 0.16
337 0.2
338 0.25
339 0.31
340 0.34
341 0.38
342 0.39
343 0.39
344 0.41
345 0.44
346 0.46
347 0.47
348 0.56
349 0.62
350 0.68
351 0.72
352 0.72
353 0.65
354 0.67
355 0.61
356 0.5
357 0.42
358 0.33
359 0.25
360 0.21
361 0.2
362 0.16
363 0.15
364 0.2
365 0.19
366 0.21
367 0.21
368 0.2
369 0.2
370 0.18
371 0.21
372 0.17
373 0.17
374 0.15
375 0.18
376 0.18
377 0.19
378 0.18
379 0.17
380 0.17
381 0.16
382 0.16
383 0.13