Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q3W8

Protein Details
Accession A0A0C3Q3W8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-71AADREAKKKKDAEKKKDKKKBasic
NLS Segment(s)
PositionSequence
55-71REAKKKKDAEKKKDKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences TEEQKMEEGRRMFSIFAARMFEQRVLQAYREKVAQDRQLQLIKELEEEDRAAADREAKKKKDAEKKKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.22
3 0.22
4 0.24
5 0.22
6 0.22
7 0.24
8 0.23
9 0.18
10 0.17
11 0.2
12 0.17
13 0.18
14 0.21
15 0.2
16 0.2
17 0.2
18 0.2
19 0.19
20 0.22
21 0.27
22 0.26
23 0.27
24 0.29
25 0.31
26 0.31
27 0.29
28 0.26
29 0.2
30 0.17
31 0.17
32 0.14
33 0.11
34 0.12
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.15
41 0.2
42 0.29
43 0.38
44 0.4
45 0.45
46 0.51
47 0.61
48 0.65
49 0.7
50 0.72
51 0.75