Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q1F5

Protein Details
Accession A0A0C3Q1F5   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-78GTNPCLCAARKKRKEKQRVANPYKKAAPHydrophilic
NLS Segment(s)
PositionSequence
60-78RKKRKEKQRVANPYKKAAP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MISREEGRCMGENHDEVTASSSRGIHNEPDESKTRNVHRAENSIPIEEERGTNPCLCAARKKRKEKQRVANPYKKAAPQREESKTLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.2
4 0.22
5 0.18
6 0.13
7 0.13
8 0.13
9 0.13
10 0.14
11 0.16
12 0.15
13 0.17
14 0.2
15 0.21
16 0.24
17 0.26
18 0.27
19 0.28
20 0.31
21 0.32
22 0.35
23 0.35
24 0.38
25 0.38
26 0.4
27 0.39
28 0.41
29 0.38
30 0.31
31 0.29
32 0.23
33 0.21
34 0.16
35 0.15
36 0.09
37 0.11
38 0.11
39 0.12
40 0.11
41 0.13
42 0.15
43 0.15
44 0.24
45 0.32
46 0.43
47 0.52
48 0.63
49 0.7
50 0.78
51 0.88
52 0.89
53 0.9
54 0.9
55 0.91
56 0.91
57 0.9
58 0.85
59 0.81
60 0.76
61 0.72
62 0.7
63 0.68
64 0.64
65 0.64
66 0.68
67 0.68
68 0.69