Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q390

Protein Details
Accession A0A0C3Q390    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-62IDIICCRCGSRRRTRSRGTRYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 7, mito 6, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences QGSVFSAIGRAINSVISAIARVFMAIVGGITTVLVAIWNFFIDIICCRCGSRRRTRSRGTRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.02
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.05
30 0.08
31 0.1
32 0.11
33 0.11
34 0.12
35 0.19
36 0.27
37 0.35
38 0.44
39 0.52
40 0.62
41 0.71
42 0.8