Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QE86

Protein Details
Accession A0A0C3QE86    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-26APFSSMLKPKKGKKPRPLTPPSPSSHydrophilic
NLS Segment(s)
PositionSequence
9-18KPKKGKKPRP
Subcellular Location(s) nucl 16.5, mito_nucl 13.999, cyto_nucl 10.666, mito 9
Family & Domain DBs
Amino Acid Sequences MAPFSSMLKPKKGKKPRPLTPPSPSSFVSPRSPSWHEQAFSQHTKTRQPSGSRPRSRSRDNIAPKGDDELAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.86
4 0.89
5 0.88
6 0.85
7 0.82
8 0.79
9 0.71
10 0.64
11 0.56
12 0.49
13 0.44
14 0.39
15 0.37
16 0.32
17 0.31
18 0.33
19 0.35
20 0.33
21 0.35
22 0.34
23 0.29
24 0.28
25 0.31
26 0.31
27 0.3
28 0.31
29 0.3
30 0.28
31 0.35
32 0.37
33 0.39
34 0.39
35 0.41
36 0.49
37 0.57
38 0.65
39 0.67
40 0.7
41 0.74
42 0.75
43 0.77
44 0.75
45 0.73
46 0.72
47 0.72
48 0.75
49 0.7
50 0.65
51 0.59
52 0.55