Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q7M8

Protein Details
Accession A0A0C3Q7M8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-104EYYKQLRERRKAAREKARKRSGSSBasic
NLS Segment(s)
PositionSequence
87-113RERRKAAREKARKRSGSSSSSSGWKPS
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MKRKFPEGWNPPKKLSRQLMDDMRDLKRLDPEKFTTDVLASQFRVSPEAVRRILRSSWTPDTKRSEELQERDEAKKAQTLEYYKQLRERRKAAREKARKRSGSSSSSSGWKPSRYGQKEGSRRPNRFDSGAEQDGFTLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.64
4 0.6
5 0.63
6 0.64
7 0.61
8 0.61
9 0.56
10 0.49
11 0.47
12 0.41
13 0.34
14 0.35
15 0.37
16 0.35
17 0.36
18 0.38
19 0.38
20 0.39
21 0.38
22 0.31
23 0.26
24 0.25
25 0.21
26 0.19
27 0.16
28 0.15
29 0.16
30 0.15
31 0.16
32 0.14
33 0.16
34 0.19
35 0.24
36 0.26
37 0.26
38 0.27
39 0.28
40 0.29
41 0.28
42 0.26
43 0.26
44 0.31
45 0.36
46 0.37
47 0.39
48 0.45
49 0.45
50 0.45
51 0.4
52 0.39
53 0.38
54 0.39
55 0.35
56 0.33
57 0.34
58 0.31
59 0.32
60 0.26
61 0.2
62 0.21
63 0.2
64 0.17
65 0.18
66 0.21
67 0.22
68 0.3
69 0.32
70 0.3
71 0.38
72 0.43
73 0.47
74 0.5
75 0.55
76 0.56
77 0.62
78 0.71
79 0.73
80 0.77
81 0.8
82 0.84
83 0.87
84 0.87
85 0.82
86 0.77
87 0.75
88 0.71
89 0.65
90 0.59
91 0.53
92 0.45
93 0.46
94 0.41
95 0.39
96 0.36
97 0.33
98 0.31
99 0.35
100 0.44
101 0.44
102 0.5
103 0.53
104 0.59
105 0.67
106 0.75
107 0.78
108 0.77
109 0.76
110 0.77
111 0.76
112 0.71
113 0.64
114 0.57
115 0.53
116 0.52
117 0.53
118 0.46
119 0.38