Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q2B3

Protein Details
Accession A0A0C3Q2B3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
219-239MDVSSSKPKPKGKGKGKGKAKBasic
NLS Segment(s)
PositionSequence
225-239KPKPKGKGKGKGKAK
Subcellular Location(s) nucl 11, cyto 10, mito 5
Family & Domain DBs
Amino Acid Sequences MSVLNQITCVWEASIDALKVAASSLTFKCLEPAAQSVHVKIPATARSRDGMGSLLAMHLSISIEKEKYMAGGVLSSAAKMSLLSCFREFLLSLSKALQGQPSEKKTWPQKLKDKREYDDLWARHSGDTQPQASRCNHHSRSLPTYEKAPAKLRTGAPKTKREPSCSSVAGPSSVHATHTELSSMATAPPPPPASARPELSPENNYPLLYDSDEPPDDVMDVSSSKPKPKGKGKGKGKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.12
5 0.11
6 0.11
7 0.11
8 0.09
9 0.05
10 0.1
11 0.1
12 0.14
13 0.16
14 0.16
15 0.17
16 0.18
17 0.19
18 0.17
19 0.19
20 0.19
21 0.24
22 0.25
23 0.25
24 0.27
25 0.28
26 0.26
27 0.25
28 0.25
29 0.27
30 0.3
31 0.3
32 0.29
33 0.28
34 0.29
35 0.28
36 0.24
37 0.18
38 0.14
39 0.12
40 0.1
41 0.09
42 0.07
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.09
50 0.09
51 0.09
52 0.1
53 0.09
54 0.09
55 0.1
56 0.08
57 0.06
58 0.06
59 0.06
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.1
70 0.13
71 0.13
72 0.14
73 0.14
74 0.15
75 0.15
76 0.12
77 0.17
78 0.15
79 0.15
80 0.15
81 0.16
82 0.16
83 0.16
84 0.17
85 0.12
86 0.16
87 0.22
88 0.25
89 0.27
90 0.28
91 0.34
92 0.39
93 0.48
94 0.51
95 0.53
96 0.6
97 0.67
98 0.76
99 0.8
100 0.77
101 0.7
102 0.69
103 0.62
104 0.58
105 0.55
106 0.45
107 0.38
108 0.34
109 0.32
110 0.25
111 0.25
112 0.2
113 0.17
114 0.2
115 0.18
116 0.2
117 0.2
118 0.24
119 0.24
120 0.26
121 0.27
122 0.33
123 0.33
124 0.35
125 0.39
126 0.39
127 0.44
128 0.47
129 0.45
130 0.36
131 0.37
132 0.38
133 0.36
134 0.35
135 0.35
136 0.32
137 0.32
138 0.37
139 0.37
140 0.41
141 0.45
142 0.5
143 0.51
144 0.57
145 0.58
146 0.63
147 0.64
148 0.61
149 0.61
150 0.56
151 0.56
152 0.48
153 0.45
154 0.38
155 0.34
156 0.29
157 0.23
158 0.19
159 0.16
160 0.14
161 0.14
162 0.12
163 0.14
164 0.13
165 0.14
166 0.14
167 0.11
168 0.11
169 0.11
170 0.1
171 0.09
172 0.09
173 0.1
174 0.1
175 0.14
176 0.15
177 0.15
178 0.18
179 0.2
180 0.26
181 0.3
182 0.32
183 0.3
184 0.34
185 0.37
186 0.38
187 0.4
188 0.35
189 0.36
190 0.35
191 0.33
192 0.28
193 0.26
194 0.25
195 0.23
196 0.22
197 0.18
198 0.22
199 0.23
200 0.22
201 0.2
202 0.18
203 0.16
204 0.15
205 0.13
206 0.09
207 0.1
208 0.11
209 0.19
210 0.21
211 0.26
212 0.34
213 0.4
214 0.48
215 0.58
216 0.67
217 0.7
218 0.78
219 0.83