Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QDF2

Protein Details
Accession A0A0C3QDF2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-100TDPSSSPERARRPTKKTKPLFRALASHydrophilic
NLS Segment(s)
PositionSequence
84-91ARRPTKKT
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
IPR028094  RTC4_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF14474  RTC4  
Amino Acid Sequences MGQSAAELFNDTDLLEDGEVMEQEDELVEDEEDFVCDKCRGVFLASRRALHLLKCIGSRKRTASARRTTSTVGPTDPSSSPERARRPTKKTKPLFRALASSTRTASSSSRNIKSRLRSATPAALVLGESDEDADQLEDDEITISRDGGAEDGDEEDEDEEGMGNRDGDDDYEDDAGPEDEDNGFGEESAGDHRAGSSVRVPSLCPFCDEILPRGISPAFKDALASALRSAIPQPLPSNPDHHELEWTRSIGVCSIHRAQTASIASGLSWPTSINFDQIPVRLLAHRQDLLAVLEGASTAHVVLEGFREGSYPLTNMSAKVGALKYSHAGYYGPQGYQLLCSSLLRMFSGESANCSSVLSYFDFVHYVLAPYASFLLIRDDLSQGSMGSEEVWKKWKYSKAHGEAFFPEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.08
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.07
16 0.07
17 0.08
18 0.09
19 0.09
20 0.1
21 0.09
22 0.1
23 0.11
24 0.12
25 0.11
26 0.13
27 0.14
28 0.17
29 0.23
30 0.26
31 0.37
32 0.4
33 0.4
34 0.4
35 0.43
36 0.42
37 0.37
38 0.38
39 0.32
40 0.32
41 0.36
42 0.42
43 0.44
44 0.47
45 0.52
46 0.5
47 0.54
48 0.59
49 0.63
50 0.65
51 0.68
52 0.71
53 0.68
54 0.66
55 0.61
56 0.58
57 0.53
58 0.46
59 0.38
60 0.32
61 0.3
62 0.31
63 0.28
64 0.26
65 0.26
66 0.27
67 0.3
68 0.36
69 0.43
70 0.47
71 0.58
72 0.64
73 0.69
74 0.76
75 0.82
76 0.84
77 0.86
78 0.88
79 0.86
80 0.86
81 0.84
82 0.75
83 0.7
84 0.63
85 0.61
86 0.53
87 0.46
88 0.37
89 0.31
90 0.29
91 0.25
92 0.24
93 0.22
94 0.28
95 0.34
96 0.4
97 0.43
98 0.47
99 0.51
100 0.56
101 0.58
102 0.57
103 0.53
104 0.5
105 0.5
106 0.51
107 0.45
108 0.38
109 0.31
110 0.23
111 0.19
112 0.15
113 0.12
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.05
123 0.05
124 0.04
125 0.04
126 0.05
127 0.05
128 0.06
129 0.06
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.08
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.07
164 0.06
165 0.06
166 0.04
167 0.05
168 0.05
169 0.06
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.06
176 0.07
177 0.06
178 0.06
179 0.06
180 0.07
181 0.07
182 0.08
183 0.1
184 0.1
185 0.11
186 0.11
187 0.12
188 0.14
189 0.18
190 0.17
191 0.15
192 0.16
193 0.15
194 0.18
195 0.19
196 0.17
197 0.17
198 0.18
199 0.16
200 0.15
201 0.15
202 0.12
203 0.12
204 0.13
205 0.11
206 0.1
207 0.1
208 0.09
209 0.12
210 0.12
211 0.11
212 0.08
213 0.09
214 0.09
215 0.09
216 0.1
217 0.1
218 0.1
219 0.11
220 0.13
221 0.14
222 0.17
223 0.18
224 0.22
225 0.21
226 0.25
227 0.25
228 0.24
229 0.27
230 0.25
231 0.29
232 0.27
233 0.25
234 0.2
235 0.19
236 0.19
237 0.15
238 0.16
239 0.12
240 0.14
241 0.17
242 0.19
243 0.19
244 0.19
245 0.18
246 0.21
247 0.21
248 0.17
249 0.14
250 0.13
251 0.12
252 0.13
253 0.13
254 0.08
255 0.07
256 0.07
257 0.07
258 0.1
259 0.11
260 0.11
261 0.1
262 0.12
263 0.14
264 0.14
265 0.15
266 0.12
267 0.13
268 0.13
269 0.15
270 0.16
271 0.19
272 0.19
273 0.17
274 0.17
275 0.17
276 0.17
277 0.16
278 0.12
279 0.08
280 0.07
281 0.07
282 0.06
283 0.05
284 0.05
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.06
291 0.06
292 0.07
293 0.07
294 0.07
295 0.08
296 0.09
297 0.1
298 0.09
299 0.09
300 0.12
301 0.13
302 0.13
303 0.14
304 0.14
305 0.13
306 0.17
307 0.16
308 0.15
309 0.15
310 0.16
311 0.16
312 0.16
313 0.17
314 0.13
315 0.13
316 0.12
317 0.19
318 0.21
319 0.19
320 0.18
321 0.19
322 0.18
323 0.2
324 0.2
325 0.14
326 0.12
327 0.12
328 0.13
329 0.14
330 0.15
331 0.13
332 0.13
333 0.12
334 0.13
335 0.17
336 0.15
337 0.17
338 0.2
339 0.2
340 0.19
341 0.19
342 0.17
343 0.14
344 0.16
345 0.14
346 0.13
347 0.13
348 0.14
349 0.14
350 0.14
351 0.15
352 0.13
353 0.13
354 0.11
355 0.11
356 0.1
357 0.1
358 0.11
359 0.09
360 0.09
361 0.08
362 0.12
363 0.13
364 0.14
365 0.15
366 0.15
367 0.15
368 0.17
369 0.17
370 0.12
371 0.11
372 0.1
373 0.09
374 0.09
375 0.14
376 0.15
377 0.17
378 0.24
379 0.25
380 0.28
381 0.36
382 0.42
383 0.45
384 0.54
385 0.62
386 0.64
387 0.72
388 0.72
389 0.69