Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PTM1

Protein Details
Accession A0A0C3PTM1   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-104ASDLRPCNRCKKNNVPCHFEKHRRGRKPGVKBasic
NLS Segment(s)
PositionSequence
94-104KHRRGRKPGVK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNTAVQDHHHHQHEEDYDLGVDEHDEIPPSSPHASTSGAGTQAAGDKKQVIRGARACMVCRAAKMRCIGGDDQASDLRPCNRCKKNNVPCHFEKHRRGRKPGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.24
4 0.2
5 0.19
6 0.18
7 0.11
8 0.09
9 0.09
10 0.08
11 0.07
12 0.08
13 0.08
14 0.1
15 0.1
16 0.12
17 0.12
18 0.12
19 0.12
20 0.14
21 0.15
22 0.14
23 0.16
24 0.14
25 0.14
26 0.13
27 0.12
28 0.1
29 0.12
30 0.13
31 0.11
32 0.09
33 0.11
34 0.12
35 0.15
36 0.18
37 0.16
38 0.2
39 0.22
40 0.25
41 0.27
42 0.28
43 0.25
44 0.24
45 0.25
46 0.21
47 0.2
48 0.21
49 0.18
50 0.2
51 0.21
52 0.21
53 0.19
54 0.22
55 0.21
56 0.21
57 0.22
58 0.19
59 0.19
60 0.19
61 0.19
62 0.16
63 0.18
64 0.2
65 0.23
66 0.28
67 0.37
68 0.45
69 0.51
70 0.6
71 0.69
72 0.73
73 0.79
74 0.8
75 0.78
76 0.74
77 0.76
78 0.77
79 0.76
80 0.76
81 0.77
82 0.8
83 0.81
84 0.85