Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LP14

Protein Details
Accession A0A0C3LP14   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-107PGEEAGPKRVRKRKVRFPKTGQKKGRGRGCBasic
NLS Segment(s)
PositionSequence
77-105KPGEEAGPKRVRKRKVRFPKTGQKKGRGR
Subcellular Location(s) cyto 15, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR045912  FOXJ2/3-like  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences PPYPYSTIIRYAIEGSPRGMLTLAEIYEVVEARFPYYKNAGMGWKNSIRHNLSLNRIFEKKPRAITEPGKGAYWTIKPGEEAGPKRVRKRKVRFPKTGQKKGRGRGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.21
4 0.2
5 0.19
6 0.16
7 0.13
8 0.12
9 0.13
10 0.12
11 0.09
12 0.09
13 0.09
14 0.1
15 0.1
16 0.08
17 0.07
18 0.07
19 0.08
20 0.11
21 0.11
22 0.13
23 0.16
24 0.17
25 0.17
26 0.18
27 0.22
28 0.22
29 0.23
30 0.25
31 0.26
32 0.26
33 0.27
34 0.32
35 0.29
36 0.29
37 0.32
38 0.31
39 0.32
40 0.36
41 0.35
42 0.33
43 0.32
44 0.31
45 0.31
46 0.33
47 0.32
48 0.31
49 0.33
50 0.35
51 0.39
52 0.43
53 0.44
54 0.43
55 0.4
56 0.36
57 0.33
58 0.29
59 0.26
60 0.23
61 0.2
62 0.15
63 0.15
64 0.15
65 0.17
66 0.22
67 0.26
68 0.27
69 0.33
70 0.41
71 0.45
72 0.54
73 0.6
74 0.64
75 0.67
76 0.75
77 0.78
78 0.81
79 0.87
80 0.88
81 0.9
82 0.92
83 0.92
84 0.92
85 0.9
86 0.89
87 0.88