Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3L8Q0

Protein Details
Accession A0A0C3L8Q0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARIRKRPRRRGQGGHWITGBasic
NLS Segment(s)
PositionSequence
4-12IRKRPRRRG
Subcellular Location(s) mito 10, plas 9, extr 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MARIRKRPRRRGQGGHWITGIGWRQGSLRELCSWELMGLVLTVSLAPGGHLTPAVVLAVVWMTLSMTCAVRTQWIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.65
4 0.54
5 0.44
6 0.38
7 0.31
8 0.21
9 0.16
10 0.13
11 0.14
12 0.15
13 0.18
14 0.15
15 0.15
16 0.15
17 0.17
18 0.17
19 0.17
20 0.15
21 0.12
22 0.1
23 0.08
24 0.07
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.06
53 0.07
54 0.08
55 0.1
56 0.1