Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3L7Z3

Protein Details
Accession A0A0C3L7Z3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38VPSRCPSRVRTGSKSKSRSKNNSYLPPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MLPLIHASSNVPSRCPSRVRTGSKSKSRSKNNSYLPPCPVQLHQTPHIFHRSQPSQPSAIDACAAVFKASIPHSTAVSVTSHDSATRNLITTFDPDNRRGPWIPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.35
4 0.38
5 0.47
6 0.53
7 0.59
8 0.66
9 0.71
10 0.76
11 0.8
12 0.8
13 0.8
14 0.82
15 0.83
16 0.81
17 0.8
18 0.79
19 0.81
20 0.76
21 0.71
22 0.65
23 0.57
24 0.51
25 0.43
26 0.36
27 0.3
28 0.3
29 0.31
30 0.32
31 0.33
32 0.32
33 0.33
34 0.37
35 0.33
36 0.29
37 0.33
38 0.31
39 0.3
40 0.32
41 0.32
42 0.28
43 0.28
44 0.29
45 0.21
46 0.18
47 0.15
48 0.12
49 0.1
50 0.08
51 0.08
52 0.05
53 0.05
54 0.04
55 0.07
56 0.08
57 0.09
58 0.11
59 0.12
60 0.12
61 0.13
62 0.13
63 0.11
64 0.11
65 0.11
66 0.11
67 0.12
68 0.11
69 0.12
70 0.13
71 0.13
72 0.17
73 0.17
74 0.16
75 0.15
76 0.16
77 0.16
78 0.19
79 0.22
80 0.25
81 0.28
82 0.3
83 0.35
84 0.35
85 0.4
86 0.38