Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E7C9

Protein Details
Accession E9E7C9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32HLYFDFKRPLRRRTPSSRAPSSVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, golg 4, E.R. 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024654  Calcineurin-like_PHP_lpxH  
IPR029052  Metallo-depent_PP-like  
IPR000979  Phosphodiesterase_MJ0936/Vps29  
IPR028661  Vps29  
Gene Ontology GO:0005829  C:cytosol  
GO:0030904  C:retromer complex  
GO:0015031  P:protein transport  
GO:0042147  P:retrograde transport, endosome to Golgi  
KEGG maw:MAC_05777  -  
Pfam View protein in Pfam  
PF12850  Metallophos_2  
CDD cd07394  MPP_Vps29  
Amino Acid Sequences MPPPAPTSRHLYFDFKRPLRRRTPSSRAPSSVRIAMAFLILVIGDLHIPDRALDIPAKFKKLLAPGKIGQTLCLGNLTDKHTYEYLRSITPDLKIVKGRNDVEATSLPLTQVVTHGSIRIGFLEGFTLVSSEPDLLLAEANRLDVDVLCWGGTHKFDAFEYMDKFFVNPGSATGAFLNSWGGVGEDPTPSFCLMDVQGISLTLYVYQLRKDDKGNENVAVEKVTYTKPVEPAANSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.64
4 0.66
5 0.72
6 0.74
7 0.8
8 0.79
9 0.79
10 0.82
11 0.81
12 0.83
13 0.82
14 0.77
15 0.73
16 0.69
17 0.64
18 0.58
19 0.49
20 0.4
21 0.32
22 0.27
23 0.22
24 0.16
25 0.1
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.07
38 0.07
39 0.09
40 0.12
41 0.12
42 0.21
43 0.24
44 0.28
45 0.26
46 0.26
47 0.29
48 0.36
49 0.42
50 0.36
51 0.39
52 0.39
53 0.43
54 0.47
55 0.43
56 0.35
57 0.3
58 0.26
59 0.2
60 0.19
61 0.14
62 0.1
63 0.13
64 0.16
65 0.16
66 0.16
67 0.18
68 0.18
69 0.19
70 0.19
71 0.2
72 0.18
73 0.17
74 0.17
75 0.17
76 0.18
77 0.18
78 0.21
79 0.19
80 0.19
81 0.23
82 0.23
83 0.26
84 0.31
85 0.31
86 0.29
87 0.29
88 0.27
89 0.25
90 0.24
91 0.21
92 0.15
93 0.15
94 0.11
95 0.1
96 0.1
97 0.07
98 0.07
99 0.06
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.09
144 0.12
145 0.13
146 0.16
147 0.17
148 0.17
149 0.17
150 0.16
151 0.16
152 0.14
153 0.14
154 0.11
155 0.09
156 0.08
157 0.12
158 0.13
159 0.14
160 0.13
161 0.13
162 0.11
163 0.12
164 0.11
165 0.06
166 0.06
167 0.05
168 0.06
169 0.05
170 0.06
171 0.07
172 0.08
173 0.08
174 0.09
175 0.11
176 0.1
177 0.1
178 0.09
179 0.11
180 0.1
181 0.13
182 0.12
183 0.12
184 0.12
185 0.12
186 0.12
187 0.1
188 0.09
189 0.06
190 0.07
191 0.09
192 0.1
193 0.12
194 0.16
195 0.2
196 0.23
197 0.27
198 0.34
199 0.39
200 0.46
201 0.48
202 0.46
203 0.44
204 0.44
205 0.4
206 0.33
207 0.25
208 0.18
209 0.17
210 0.16
211 0.19
212 0.2
213 0.23
214 0.25
215 0.3
216 0.33