Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LHP3

Protein Details
Accession A0A0C3LHP3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MVKIIKKRTKTFRRHQYDRWDRVPESWRKPRGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
26-46SWRKPRGIDNRVRRRFKGSAP
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVKIIKKRTKTFRRHQYDRWDRVPESWRKPRGIDNRVRRRFKGSAPMPKVGYGSDKRTKFVMPNGLRKLRVTNVNDVDVLLMHNKSYAVEIARTVGGRKRVAILERAKALGLKVTNPHAKVRTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.87
4 0.87
5 0.85
6 0.81
7 0.76
8 0.67
9 0.65
10 0.66
11 0.64
12 0.62
13 0.64
14 0.63
15 0.59
16 0.6
17 0.63
18 0.65
19 0.65
20 0.65
21 0.66
22 0.72
23 0.79
24 0.82
25 0.74
26 0.71
27 0.66
28 0.6
29 0.6
30 0.57
31 0.58
32 0.57
33 0.59
34 0.52
35 0.49
36 0.45
37 0.35
38 0.33
39 0.25
40 0.27
41 0.31
42 0.31
43 0.31
44 0.32
45 0.32
46 0.28
47 0.29
48 0.32
49 0.29
50 0.37
51 0.42
52 0.44
53 0.44
54 0.42
55 0.41
56 0.34
57 0.37
58 0.32
59 0.33
60 0.32
61 0.33
62 0.32
63 0.29
64 0.25
65 0.18
66 0.15
67 0.1
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.09
78 0.11
79 0.12
80 0.12
81 0.13
82 0.15
83 0.2
84 0.2
85 0.21
86 0.23
87 0.26
88 0.28
89 0.34
90 0.35
91 0.35
92 0.37
93 0.37
94 0.33
95 0.3
96 0.28
97 0.26
98 0.22
99 0.19
100 0.21
101 0.28
102 0.34
103 0.36
104 0.42
105 0.41