Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3K9D8

Protein Details
Accession A0A0C3K9D8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-90APPPVIRSRKARHCIKCQKDTSPSTKKKKANKHydrophilic
NLS Segment(s)
PositionSequence
84-90KKKKANK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MPLQPPLPDLWETADLIHSHGHQHNKVQYGYMPEVPARKRKAAEAQQSTQAATSSHPSAPPPVIRSRKARHCIKCQKDTSPSTKKKKANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.16
4 0.17
5 0.13
6 0.16
7 0.2
8 0.26
9 0.25
10 0.31
11 0.34
12 0.37
13 0.36
14 0.33
15 0.3
16 0.3
17 0.31
18 0.27
19 0.23
20 0.2
21 0.25
22 0.27
23 0.32
24 0.3
25 0.3
26 0.29
27 0.32
28 0.4
29 0.43
30 0.5
31 0.48
32 0.47
33 0.48
34 0.47
35 0.44
36 0.35
37 0.27
38 0.18
39 0.13
40 0.13
41 0.11
42 0.11
43 0.12
44 0.12
45 0.14
46 0.17
47 0.19
48 0.2
49 0.27
50 0.32
51 0.37
52 0.45
53 0.51
54 0.59
55 0.65
56 0.71
57 0.71
58 0.76
59 0.82
60 0.83
61 0.84
62 0.79
63 0.78
64 0.77
65 0.76
66 0.75
67 0.75
68 0.76
69 0.77
70 0.81