Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q3J0

Protein Details
Accession A0A0C3Q3J0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-184RAVLKDKAYKRRRGKKTTDAEGBasic
NLS Segment(s)
PositionSequence
163-178RAVLKDKAYKRRRGKK
Subcellular Location(s) cyto_nucl 13.166, nucl 13, cyto 11, cyto_mito 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR046985  IP5  
IPR000300  IPPc  
Gene Ontology GO:0016791  F:phosphatase activity  
GO:0046856  P:phosphatidylinositol dephosphorylation  
Amino Acid Sequences MEGTSKSAVTTGLIGGRIGNKGGVGISLKVAGVSLLFVNAHLAAHEERAAVRVANMAKIKTDLDLDSFLEPDDTRATSEDITDHFDHAFIFGDLNFRLNVTRLHAEWLISRRDYETALTFDQLKEVMKGPDHPFVGFTEGDINFPPTFKYDILRTLKKHHSVRAVLKDKAYKRRRGKKTTDAEGLPDVDDVSESSSSSSSEEDNGDQDARSMASSAYRSVHSKSMKDEDSGDPDSLDAAAQNAIVNSASYTSDVQAVALRAKEKFLSLVNRPPSPAVGALTTSAPKGSLPVADIVSVPKRPKSEINVSPKVPPSPLLPPIAPGMKSAASSFDVPRSSLEGLKPPPLKRAHSTKSGAAAKEPEEKEDNSYPDRGVYDTSSKQRVPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.17
5 0.17
6 0.15
7 0.12
8 0.12
9 0.12
10 0.12
11 0.12
12 0.11
13 0.12
14 0.12
15 0.12
16 0.11
17 0.11
18 0.09
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.08
28 0.07
29 0.1
30 0.09
31 0.11
32 0.12
33 0.11
34 0.11
35 0.13
36 0.14
37 0.11
38 0.1
39 0.14
40 0.14
41 0.19
42 0.22
43 0.21
44 0.21
45 0.23
46 0.23
47 0.19
48 0.2
49 0.15
50 0.15
51 0.17
52 0.17
53 0.16
54 0.16
55 0.15
56 0.14
57 0.13
58 0.12
59 0.12
60 0.11
61 0.11
62 0.13
63 0.14
64 0.13
65 0.14
66 0.14
67 0.13
68 0.18
69 0.18
70 0.18
71 0.16
72 0.16
73 0.15
74 0.14
75 0.14
76 0.08
77 0.08
78 0.07
79 0.1
80 0.1
81 0.11
82 0.1
83 0.09
84 0.1
85 0.11
86 0.12
87 0.14
88 0.16
89 0.16
90 0.2
91 0.2
92 0.2
93 0.23
94 0.26
95 0.26
96 0.23
97 0.24
98 0.21
99 0.22
100 0.22
101 0.19
102 0.18
103 0.17
104 0.17
105 0.17
106 0.17
107 0.16
108 0.16
109 0.15
110 0.13
111 0.11
112 0.12
113 0.13
114 0.13
115 0.19
116 0.21
117 0.26
118 0.26
119 0.24
120 0.23
121 0.22
122 0.24
123 0.18
124 0.15
125 0.15
126 0.14
127 0.15
128 0.14
129 0.16
130 0.13
131 0.14
132 0.14
133 0.1
134 0.13
135 0.12
136 0.14
137 0.13
138 0.22
139 0.28
140 0.33
141 0.33
142 0.39
143 0.45
144 0.51
145 0.53
146 0.49
147 0.5
148 0.51
149 0.56
150 0.59
151 0.58
152 0.51
153 0.51
154 0.53
155 0.51
156 0.56
157 0.56
158 0.55
159 0.6
160 0.69
161 0.76
162 0.79
163 0.81
164 0.81
165 0.82
166 0.79
167 0.74
168 0.63
169 0.55
170 0.47
171 0.39
172 0.29
173 0.21
174 0.13
175 0.08
176 0.07
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.07
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.07
196 0.06
197 0.06
198 0.06
199 0.05
200 0.07
201 0.08
202 0.09
203 0.1
204 0.11
205 0.13
206 0.14
207 0.21
208 0.21
209 0.22
210 0.25
211 0.29
212 0.29
213 0.29
214 0.3
215 0.26
216 0.29
217 0.29
218 0.25
219 0.19
220 0.18
221 0.17
222 0.13
223 0.11
224 0.05
225 0.04
226 0.04
227 0.04
228 0.05
229 0.04
230 0.05
231 0.05
232 0.05
233 0.04
234 0.05
235 0.05
236 0.06
237 0.07
238 0.07
239 0.09
240 0.09
241 0.09
242 0.09
243 0.1
244 0.11
245 0.12
246 0.13
247 0.11
248 0.13
249 0.13
250 0.12
251 0.13
252 0.15
253 0.2
254 0.22
255 0.3
256 0.34
257 0.34
258 0.35
259 0.34
260 0.31
261 0.26
262 0.23
263 0.16
264 0.13
265 0.12
266 0.12
267 0.13
268 0.13
269 0.11
270 0.1
271 0.09
272 0.08
273 0.08
274 0.09
275 0.08
276 0.09
277 0.11
278 0.11
279 0.12
280 0.12
281 0.14
282 0.17
283 0.2
284 0.21
285 0.22
286 0.23
287 0.26
288 0.32
289 0.37
290 0.43
291 0.48
292 0.56
293 0.6
294 0.59
295 0.62
296 0.59
297 0.53
298 0.44
299 0.37
300 0.31
301 0.31
302 0.33
303 0.32
304 0.29
305 0.28
306 0.32
307 0.33
308 0.29
309 0.24
310 0.23
311 0.2
312 0.2
313 0.19
314 0.18
315 0.16
316 0.19
317 0.2
318 0.22
319 0.22
320 0.21
321 0.22
322 0.24
323 0.23
324 0.24
325 0.25
326 0.28
327 0.3
328 0.38
329 0.43
330 0.41
331 0.47
332 0.49
333 0.52
334 0.52
335 0.6
336 0.57
337 0.6
338 0.63
339 0.59
340 0.63
341 0.63
342 0.56
343 0.5
344 0.47
345 0.42
346 0.47
347 0.44
348 0.39
349 0.37
350 0.38
351 0.4
352 0.43
353 0.44
354 0.38
355 0.39
356 0.35
357 0.34
358 0.34
359 0.28
360 0.25
361 0.24
362 0.28
363 0.33
364 0.4
365 0.44