Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QPK8

Protein Details
Accession A0A0C3QPK8   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-47DGEGPAKKKKKSSSKSKKDKIKEGAVDBasic
82-101KKFEESQRKRREEKVRRMATBasic
NLS Segment(s)
PositionSequence
23-42EGPAKKKKKSSSKSKKDKIK
88-100QRKRREEKVRRMA
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDPYAFRPGGSLKLKRTADDGEGPAKKKKKSSSKSKKDKIKEGAVDKSALEAVESSNEPGSSKAAADEGDTEADGKTAAEKKFEESQRKRREEKVRRMATKTHKDRVHEFNSKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.45
4 0.47
5 0.41
6 0.38
7 0.38
8 0.36
9 0.35
10 0.39
11 0.41
12 0.45
13 0.48
14 0.47
15 0.48
16 0.55
17 0.57
18 0.63
19 0.71
20 0.75
21 0.8
22 0.88
23 0.91
24 0.91
25 0.87
26 0.87
27 0.83
28 0.8
29 0.76
30 0.71
31 0.67
32 0.58
33 0.51
34 0.41
35 0.34
36 0.26
37 0.18
38 0.13
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.06
61 0.06
62 0.06
63 0.04
64 0.06
65 0.12
66 0.12
67 0.14
68 0.15
69 0.19
70 0.27
71 0.33
72 0.41
73 0.45
74 0.55
75 0.64
76 0.7
77 0.71
78 0.72
79 0.77
80 0.77
81 0.8
82 0.8
83 0.8
84 0.78
85 0.78
86 0.78
87 0.77
88 0.77
89 0.74
90 0.72
91 0.66
92 0.65
93 0.68
94 0.68
95 0.67
96 0.64
97 0.58
98 0.55
99 0.55
100 0.51
101 0.44
102 0.36
103 0.29
104 0.23
105 0.26
106 0.24
107 0.22
108 0.23
109 0.25
110 0.24