Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QC91

Protein Details
Accession A0A0C3QC91    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-63KAKTPCLAKREQKNSRRLPQPRPVREETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLQTASVARSNGPLGRLLLETGITHILAPLDEASSKAKTPCLAKREQKNSRRLPQPRPVREETSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.15
5 0.13
6 0.12
7 0.1
8 0.1
9 0.1
10 0.08
11 0.07
12 0.07
13 0.06
14 0.05
15 0.06
16 0.05
17 0.04
18 0.04
19 0.05
20 0.07
21 0.08
22 0.09
23 0.09
24 0.1
25 0.13
26 0.18
27 0.24
28 0.27
29 0.35
30 0.43
31 0.52
32 0.62
33 0.7
34 0.73
35 0.77
36 0.81
37 0.82
38 0.84
39 0.82
40 0.8
41 0.8
42 0.83
43 0.82
44 0.81
45 0.78