Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3MD54

Protein Details
Accession A0A0C3MD54    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDVKTILRRSSRPKERRRAHRTTEGAHydrophilic
NLS Segment(s)
PositionSequence
9-20RSSRPKERRRAH
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MDVKTILRRSSRPKERRRAHRTTEGAMGEAHVKTRMAQRATSHQSCTPSWPPQGRFQGSPRGGRVCKEPHLEHSPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.91
4 0.9
5 0.88
6 0.85
7 0.85
8 0.79
9 0.71
10 0.67
11 0.56
12 0.47
13 0.37
14 0.3
15 0.22
16 0.17
17 0.15
18 0.09
19 0.09
20 0.09
21 0.15
22 0.19
23 0.19
24 0.2
25 0.22
26 0.3
27 0.37
28 0.37
29 0.35
30 0.32
31 0.34
32 0.32
33 0.37
34 0.33
35 0.31
36 0.35
37 0.39
38 0.4
39 0.45
40 0.53
41 0.5
42 0.49
43 0.48
44 0.52
45 0.5
46 0.52
47 0.47
48 0.47
49 0.45
50 0.43
51 0.47
52 0.43
53 0.46
54 0.49
55 0.48
56 0.47