Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q1R6

Protein Details
Accession A0A0C3Q1R6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61DSWNKGKQWKDIRHNYVQQEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, mito 1, plas 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSLANNFYNLIFKRNSVYVPVVFASAFAFGIGFDLGTTAFWDSWNKGKQWKDIRHNYVQQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.21
4 0.23
5 0.2
6 0.21
7 0.2
8 0.17
9 0.15
10 0.14
11 0.11
12 0.08
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.05
27 0.06
28 0.08
29 0.09
30 0.17
31 0.21
32 0.22
33 0.28
34 0.33
35 0.42
36 0.5
37 0.59
38 0.62
39 0.69
40 0.75
41 0.78
42 0.81