Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KEL9

Protein Details
Accession A0A0C3KEL9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
147-169IFQMRLDEHKKRRQAREVKEVAPHydrophilic
NLS Segment(s)
PositionSequence
76-111EEKQKAKKEKEEALKKEKEKEKEKEKEKDGKDKGAD
Subcellular Location(s) mito 18, mito_nucl 12.166, cyto_mito 11.166, nucl 5, cyto_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFQNVYYKRAVGTAKQCYICLKQTTTVLATVDVVDFLYTCDNHLSDPGFATLVSAEPSKPQVSAEEIERVKKEYEEKQKAKKEKEEALKKEKEKEKEKEKEKDGKDKGADTKTAAVPKKSTSPAATPTPPAPATPSHQKYVLHRQIFQMRLDEHKKRRQAREVKEVAPKFPIAPRSSVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.46
4 0.47
5 0.46
6 0.48
7 0.48
8 0.43
9 0.38
10 0.34
11 0.35
12 0.37
13 0.34
14 0.31
15 0.25
16 0.21
17 0.18
18 0.15
19 0.13
20 0.1
21 0.08
22 0.06
23 0.06
24 0.06
25 0.08
26 0.07
27 0.08
28 0.09
29 0.09
30 0.1
31 0.12
32 0.12
33 0.1
34 0.12
35 0.11
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.08
42 0.07
43 0.07
44 0.08
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.13
51 0.15
52 0.16
53 0.2
54 0.21
55 0.23
56 0.23
57 0.23
58 0.21
59 0.21
60 0.23
61 0.25
62 0.35
63 0.43
64 0.49
65 0.56
66 0.64
67 0.69
68 0.7
69 0.68
70 0.63
71 0.61
72 0.65
73 0.65
74 0.63
75 0.65
76 0.66
77 0.61
78 0.64
79 0.62
80 0.6
81 0.59
82 0.6
83 0.62
84 0.65
85 0.71
86 0.7
87 0.71
88 0.72
89 0.68
90 0.71
91 0.63
92 0.6
93 0.54
94 0.5
95 0.49
96 0.43
97 0.39
98 0.3
99 0.31
100 0.28
101 0.33
102 0.31
103 0.26
104 0.25
105 0.26
106 0.31
107 0.29
108 0.29
109 0.25
110 0.27
111 0.3
112 0.34
113 0.33
114 0.3
115 0.29
116 0.31
117 0.28
118 0.25
119 0.23
120 0.2
121 0.24
122 0.32
123 0.35
124 0.33
125 0.36
126 0.37
127 0.42
128 0.5
129 0.54
130 0.47
131 0.45
132 0.49
133 0.54
134 0.55
135 0.5
136 0.44
137 0.36
138 0.41
139 0.48
140 0.51
141 0.52
142 0.58
143 0.66
144 0.69
145 0.77
146 0.79
147 0.81
148 0.81
149 0.83
150 0.81
151 0.78
152 0.79
153 0.72
154 0.63
155 0.57
156 0.49
157 0.4
158 0.39
159 0.4
160 0.33