Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EC68

Protein Details
Accession E9EC68   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-55DPIAQKSFPKEKKTRIEPSKLTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 4, cyto 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0016740  F:transferase activity  
GO:0005975  P:carbohydrate metabolic process  
KEGG maw:MAC_07437  -  
Pfam View protein in Pfam  
PF00722  Glyco_hydro_16  
PROSITE View protein in PROSITE  
PS51762  GH16_2  
Amino Acid Sequences MLRPYWTVCLAALTAASLKDLANCDPLRKDMRNDPIAQKSFPKEKKTRIEPSKLTVPSDCPPDAAFAGKASFDFTTAKWENVLDFWAVDEATAKDKKRLDLDTDGDGAAMGMWKPGDAPTLVSSKYLLFGKVSVTLRAAKGSGLITAVVLKSDSGDEIDWELLGAYDNQAQTNYFYDGQALFNTYNDTYDLAASSFDAFQKYSLEWTDQFLSFSVNDTIRKVWYVGEIPAAKWPQTPMQVKLGVWSVSNDSDRGEVEWAGGVPDWAAAPYKGFFRSVEVEDYTGFCNRTDGHVEYQYDERTVGWQKVRIAGCRGRPGPELPTPSPVRTGGATATETGEDGGPEKTGAGDDNGGGGGVWYVGEIPAAKWPQTPMQVKLGVWSVSNDSDRGEVEWAGGVPDWAAAPYKGFFRSVEVEDYTGFCNRTDGHVEYQYDERTVGWQKVRIAGCRGRPGPELPTPSPVRTGGATATETGEDGGPEKTGAGDDNGGAGLSTGPSSTLAAVLCLVWFLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.09
5 0.09
6 0.12
7 0.15
8 0.16
9 0.22
10 0.23
11 0.27
12 0.29
13 0.35
14 0.39
15 0.41
16 0.45
17 0.46
18 0.55
19 0.57
20 0.61
21 0.62
22 0.64
23 0.64
24 0.6
25 0.58
26 0.56
27 0.6
28 0.61
29 0.64
30 0.62
31 0.68
32 0.76
33 0.79
34 0.83
35 0.82
36 0.85
37 0.79
38 0.78
39 0.78
40 0.69
41 0.63
42 0.55
43 0.5
44 0.44
45 0.45
46 0.38
47 0.3
48 0.28
49 0.28
50 0.26
51 0.24
52 0.2
53 0.15
54 0.15
55 0.14
56 0.14
57 0.13
58 0.12
59 0.12
60 0.13
61 0.12
62 0.21
63 0.22
64 0.22
65 0.21
66 0.21
67 0.2
68 0.19
69 0.21
70 0.12
71 0.1
72 0.1
73 0.1
74 0.09
75 0.08
76 0.09
77 0.09
78 0.14
79 0.19
80 0.2
81 0.25
82 0.28
83 0.32
84 0.36
85 0.39
86 0.39
87 0.41
88 0.43
89 0.41
90 0.39
91 0.35
92 0.29
93 0.25
94 0.19
95 0.12
96 0.09
97 0.06
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.08
104 0.07
105 0.1
106 0.11
107 0.15
108 0.15
109 0.15
110 0.16
111 0.14
112 0.17
113 0.16
114 0.14
115 0.11
116 0.12
117 0.13
118 0.19
119 0.2
120 0.18
121 0.19
122 0.21
123 0.21
124 0.22
125 0.21
126 0.13
127 0.14
128 0.13
129 0.12
130 0.09
131 0.09
132 0.08
133 0.09
134 0.09
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.08
145 0.08
146 0.07
147 0.07
148 0.06
149 0.05
150 0.06
151 0.05
152 0.05
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.1
159 0.12
160 0.14
161 0.12
162 0.11
163 0.13
164 0.13
165 0.14
166 0.13
167 0.13
168 0.1
169 0.1
170 0.12
171 0.1
172 0.1
173 0.1
174 0.1
175 0.08
176 0.09
177 0.09
178 0.07
179 0.07
180 0.06
181 0.07
182 0.07
183 0.07
184 0.08
185 0.07
186 0.08
187 0.09
188 0.09
189 0.1
190 0.1
191 0.12
192 0.12
193 0.14
194 0.16
195 0.15
196 0.15
197 0.13
198 0.14
199 0.12
200 0.13
201 0.13
202 0.12
203 0.12
204 0.13
205 0.14
206 0.13
207 0.13
208 0.12
209 0.1
210 0.11
211 0.12
212 0.11
213 0.15
214 0.15
215 0.15
216 0.19
217 0.19
218 0.17
219 0.16
220 0.17
221 0.15
222 0.22
223 0.24
224 0.22
225 0.26
226 0.28
227 0.27
228 0.27
229 0.26
230 0.19
231 0.17
232 0.15
233 0.12
234 0.12
235 0.12
236 0.11
237 0.09
238 0.1
239 0.1
240 0.09
241 0.09
242 0.07
243 0.06
244 0.07
245 0.06
246 0.06
247 0.05
248 0.04
249 0.03
250 0.04
251 0.03
252 0.03
253 0.04
254 0.04
255 0.04
256 0.05
257 0.07
258 0.08
259 0.09
260 0.09
261 0.11
262 0.15
263 0.15
264 0.17
265 0.16
266 0.16
267 0.15
268 0.16
269 0.14
270 0.13
271 0.12
272 0.09
273 0.1
274 0.1
275 0.12
276 0.15
277 0.16
278 0.18
279 0.21
280 0.22
281 0.22
282 0.24
283 0.22
284 0.19
285 0.17
286 0.13
287 0.13
288 0.15
289 0.17
290 0.17
291 0.2
292 0.2
293 0.27
294 0.29
295 0.28
296 0.31
297 0.32
298 0.35
299 0.39
300 0.39
301 0.36
302 0.36
303 0.35
304 0.35
305 0.35
306 0.37
307 0.3
308 0.36
309 0.35
310 0.34
311 0.34
312 0.29
313 0.25
314 0.19
315 0.19
316 0.13
317 0.13
318 0.13
319 0.11
320 0.11
321 0.1
322 0.1
323 0.09
324 0.08
325 0.06
326 0.07
327 0.06
328 0.06
329 0.06
330 0.06
331 0.05
332 0.06
333 0.06
334 0.06
335 0.06
336 0.06
337 0.07
338 0.07
339 0.06
340 0.06
341 0.05
342 0.04
343 0.03
344 0.03
345 0.02
346 0.03
347 0.03
348 0.04
349 0.04
350 0.04
351 0.09
352 0.1
353 0.1
354 0.1
355 0.12
356 0.15
357 0.22
358 0.24
359 0.22
360 0.26
361 0.28
362 0.27
363 0.27
364 0.26
365 0.19
366 0.17
367 0.15
368 0.12
369 0.12
370 0.12
371 0.11
372 0.09
373 0.1
374 0.1
375 0.09
376 0.09
377 0.07
378 0.06
379 0.07
380 0.06
381 0.06
382 0.05
383 0.04
384 0.03
385 0.04
386 0.03
387 0.03
388 0.04
389 0.04
390 0.04
391 0.05
392 0.07
393 0.08
394 0.09
395 0.09
396 0.11
397 0.15
398 0.15
399 0.17
400 0.16
401 0.16
402 0.15
403 0.16
404 0.14
405 0.13
406 0.12
407 0.09
408 0.1
409 0.1
410 0.12
411 0.15
412 0.16
413 0.18
414 0.21
415 0.22
416 0.22
417 0.24
418 0.22
419 0.19
420 0.17
421 0.13
422 0.13
423 0.15
424 0.17
425 0.17
426 0.2
427 0.2
428 0.27
429 0.29
430 0.28
431 0.31
432 0.32
433 0.35
434 0.39
435 0.39
436 0.36
437 0.36
438 0.35
439 0.35
440 0.35
441 0.37
442 0.3
443 0.36
444 0.35
445 0.34
446 0.34
447 0.29
448 0.25
449 0.19
450 0.19
451 0.13
452 0.13
453 0.13
454 0.11
455 0.11
456 0.1
457 0.1
458 0.09
459 0.08
460 0.06
461 0.07
462 0.06
463 0.06
464 0.06
465 0.06
466 0.05
467 0.06
468 0.06
469 0.06
470 0.07
471 0.07
472 0.08
473 0.08
474 0.08
475 0.08
476 0.07
477 0.07
478 0.06
479 0.07
480 0.06
481 0.06
482 0.07
483 0.08
484 0.08
485 0.1
486 0.09
487 0.09
488 0.1
489 0.1
490 0.09
491 0.08