Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3LES6

Protein Details
Accession A0A0C3LES6    Localization Confidence High Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-69HASPDPGKKRRGRPPGSKNKKTLABasic
78-100PAAPPPPKRPRGRPRKPRTEAELBasic
104-127RQKALMPRRPRGRPPKSKRCSASRBasic
NLS Segment(s)
PositionSequence
41-130KSKANHASPDPGKKRRGRPPGSKNKKTLAAEAAAAGVPAAPPPPKRPRGRPRKPRTEAELEAERQKALMPRRPRGRPPKSKRCSASRAKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MPTKRPREEDDQSNHDEEEVDQVVESDAEEPTAASSREAGKSKANHASPDPGKKRRGRPPGSKNKKTLAAEAAAAGVPAAPPPPKRPRGRPRKPRTEAELEAERQKALMPRRPRGRPPKSKRCSASRAKVGRRLSCHHLQWCRAWTVHLRRRCCCRWAFDSKEVARIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.44
3 0.37
4 0.27
5 0.25
6 0.19
7 0.14
8 0.12
9 0.12
10 0.12
11 0.12
12 0.11
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.06
19 0.09
20 0.09
21 0.08
22 0.1
23 0.13
24 0.19
25 0.21
26 0.22
27 0.26
28 0.28
29 0.34
30 0.4
31 0.38
32 0.36
33 0.36
34 0.43
35 0.42
36 0.5
37 0.52
38 0.51
39 0.57
40 0.62
41 0.69
42 0.7
43 0.76
44 0.74
45 0.77
46 0.81
47 0.85
48 0.88
49 0.86
50 0.81
51 0.75
52 0.73
53 0.64
54 0.56
55 0.47
56 0.38
57 0.3
58 0.26
59 0.21
60 0.13
61 0.11
62 0.08
63 0.05
64 0.04
65 0.03
66 0.04
67 0.05
68 0.07
69 0.13
70 0.21
71 0.29
72 0.34
73 0.45
74 0.55
75 0.65
76 0.75
77 0.8
78 0.82
79 0.86
80 0.87
81 0.82
82 0.78
83 0.75
84 0.66
85 0.6
86 0.55
87 0.46
88 0.43
89 0.38
90 0.3
91 0.22
92 0.21
93 0.21
94 0.21
95 0.28
96 0.32
97 0.4
98 0.49
99 0.55
100 0.64
101 0.7
102 0.75
103 0.78
104 0.82
105 0.85
106 0.82
107 0.85
108 0.82
109 0.79
110 0.77
111 0.76
112 0.75
113 0.74
114 0.78
115 0.75
116 0.77
117 0.76
118 0.73
119 0.69
120 0.64
121 0.62
122 0.6
123 0.6
124 0.6
125 0.6
126 0.58
127 0.58
128 0.56
129 0.53
130 0.45
131 0.42
132 0.43
133 0.47
134 0.52
135 0.54
136 0.56
137 0.59
138 0.68
139 0.7
140 0.68
141 0.63
142 0.63
143 0.63
144 0.66
145 0.68
146 0.66
147 0.71
148 0.65