Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3K346

Protein Details
Accession A0A0C3K346    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-53RNHARAQQQRLRQRQRPIRPCRFQGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 7, plas 5, vacu 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MVMITTQLAAIVATGIAVSGVSAAALPARNHARAQQQRLRQRQRPIRPCRFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.03
12 0.05
13 0.06
14 0.09
15 0.12
16 0.13
17 0.14
18 0.18
19 0.27
20 0.32
21 0.41
22 0.45
23 0.52
24 0.6
25 0.71
26 0.77
27 0.74
28 0.78
29 0.8
30 0.84
31 0.86
32 0.87
33 0.88