Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QAT5

Protein Details
Accession A0A0C3QAT5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-39ISSGRPRRSSRHCRLPFLRKRTLSKPKHFKPSVHydrophilic
NLS Segment(s)
PositionSequence
25-32RKRTLSKP
Subcellular Location(s) nucl 13, mito_nucl 11.999, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSILRSISSGRPRRSSRHCRLPFLRKRTLSKPKHFKPSVAIDLGTVPKQRKSVGRWIGDAASSRVFALQSGTWRHNTLIERRLQPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.74
4 0.76
5 0.77
6 0.77
7 0.81
8 0.83
9 0.82
10 0.8
11 0.79
12 0.74
13 0.74
14 0.75
15 0.77
16 0.76
17 0.76
18 0.79
19 0.77
20 0.81
21 0.76
22 0.67
23 0.62
24 0.6
25 0.54
26 0.44
27 0.37
28 0.26
29 0.26
30 0.26
31 0.21
32 0.16
33 0.13
34 0.14
35 0.15
36 0.18
37 0.21
38 0.25
39 0.33
40 0.39
41 0.41
42 0.4
43 0.4
44 0.39
45 0.35
46 0.32
47 0.24
48 0.17
49 0.15
50 0.13
51 0.12
52 0.11
53 0.1
54 0.11
55 0.11
56 0.15
57 0.2
58 0.23
59 0.25
60 0.26
61 0.27
62 0.3
63 0.33
64 0.36
65 0.38
66 0.43