Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q5K6

Protein Details
Accession A0A0C3Q5K6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-125QVPKKQPKSSIYERRRSRKRSSPTIVRVLRFHydrophilic
NLS Segment(s)
PositionSequence
107-114ERRRSRKR
Subcellular Location(s) mito 12, cyto_nucl 10, nucl 9.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR003965  Fatty_acid_synthase  
Gene Ontology GO:0005835  C:fatty acid synthase complex  
GO:0004312  F:fatty acid synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Amino Acid Sequences DGKVHIDSTFSRLLGKPPIMVAGMTSTTIKAGFVSAVLSAGYHVELAGGGYYNPKALPAKVAEIQAKIPTCVGITLNALYINQRPEGFCVAAGIQVPKKQPKSSIYERRRSRKRSSPTIVRVLRFSSDQVQIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.25
4 0.22
5 0.24
6 0.21
7 0.2
8 0.17
9 0.13
10 0.12
11 0.12
12 0.12
13 0.1
14 0.1
15 0.1
16 0.09
17 0.07
18 0.06
19 0.06
20 0.05
21 0.06
22 0.05
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.04
35 0.03
36 0.03
37 0.04
38 0.05
39 0.05
40 0.05
41 0.07
42 0.08
43 0.08
44 0.1
45 0.11
46 0.14
47 0.16
48 0.19
49 0.18
50 0.18
51 0.19
52 0.19
53 0.18
54 0.15
55 0.13
56 0.1
57 0.09
58 0.09
59 0.08
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.1
70 0.11
71 0.11
72 0.13
73 0.15
74 0.15
75 0.12
76 0.12
77 0.11
78 0.11
79 0.12
80 0.13
81 0.12
82 0.15
83 0.19
84 0.25
85 0.29
86 0.3
87 0.35
88 0.38
89 0.45
90 0.52
91 0.59
92 0.62
93 0.68
94 0.75
95 0.8
96 0.85
97 0.84
98 0.83
99 0.82
100 0.82
101 0.83
102 0.83
103 0.83
104 0.81
105 0.84
106 0.81
107 0.73
108 0.66
109 0.58
110 0.51
111 0.42
112 0.37
113 0.32