Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q6X2

Protein Details
Accession A0A0C3Q6X2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-121AGVGPDGKKKRGPRKKKEPVDBasic
NLS Segment(s)
PositionSequence
107-118GKKKRGPRKKKE
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKNKNKSTKFPVARIKKIMQKDDEVGKVAQATPVLISKSLELFMATLVDEMSKVTVERGCKRVEVWHLKAAIERTEMLDFLKEIVDPIQDPYPNGADEGTAGVGPDGKKKRGPRKKKEPVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.71
4 0.72
5 0.7
6 0.63
7 0.58
8 0.56
9 0.55
10 0.5
11 0.45
12 0.37
13 0.3
14 0.27
15 0.22
16 0.19
17 0.13
18 0.11
19 0.09
20 0.11
21 0.11
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.09
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.07
43 0.11
44 0.15
45 0.17
46 0.18
47 0.18
48 0.19
49 0.22
50 0.28
51 0.33
52 0.33
53 0.34
54 0.34
55 0.34
56 0.35
57 0.32
58 0.25
59 0.18
60 0.15
61 0.13
62 0.13
63 0.13
64 0.11
65 0.1
66 0.09
67 0.08
68 0.08
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.1
75 0.13
76 0.13
77 0.14
78 0.16
79 0.17
80 0.16
81 0.16
82 0.14
83 0.1
84 0.1
85 0.1
86 0.08
87 0.06
88 0.06
89 0.06
90 0.09
91 0.1
92 0.18
93 0.22
94 0.25
95 0.32
96 0.43
97 0.54
98 0.62
99 0.73
100 0.76
101 0.82