Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q069

Protein Details
Accession A0A0C3Q069    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MGSFSKGKRRRIQFRQRTSRKKRLRRRTAEIKGWDRBasic
NLS Segment(s)
PositionSequence
6-28KGKRRRIQFRQRTSRKKRLRRRT
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGSFSKGKRRRIQFRQRTSRKKRLRRRTAEIKGWDRIEALGFLLPSLDWTGPVQNIPQSPAKIDDVAHQKLQELLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.93
4 0.94
5 0.93
6 0.93
7 0.93
8 0.93
9 0.92
10 0.92
11 0.93
12 0.91
13 0.9
14 0.9
15 0.88
16 0.86
17 0.83
18 0.76
19 0.7
20 0.61
21 0.52
22 0.41
23 0.32
24 0.24
25 0.15
26 0.11
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.1
40 0.1
41 0.12
42 0.13
43 0.15
44 0.19
45 0.19
46 0.2
47 0.23
48 0.24
49 0.22
50 0.22
51 0.26
52 0.29
53 0.33
54 0.34
55 0.3
56 0.29