Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QCZ5

Protein Details
Accession A0A0C3QCZ5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
72-92IMRGRRRWARWWTKRWRRIGMHydrophilic
NLS Segment(s)
PositionSequence
76-86RRRWARWWTKR
Subcellular Location(s) cysk 11, nucl 6.5, cyto_nucl 6.5, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MASASKSLGETPKIGALGEELEGGCDDHGHSIPGWDGTPPPEAVLNSLNVDLHLALNAQKELCVMPSSGEEIMRGRRRWARWWTKRWRRIGMGELWRLGEGVLDEGVNPLVNIHESSPMLHGAEYLGALDDWVAAGLRHVQNKGFPPSSQLPSLPDTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.14
5 0.13
6 0.12
7 0.08
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.08
18 0.09
19 0.1
20 0.11
21 0.11
22 0.09
23 0.1
24 0.11
25 0.13
26 0.12
27 0.12
28 0.13
29 0.13
30 0.14
31 0.15
32 0.14
33 0.12
34 0.13
35 0.12
36 0.1
37 0.1
38 0.08
39 0.07
40 0.06
41 0.05
42 0.06
43 0.07
44 0.08
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.09
57 0.08
58 0.09
59 0.16
60 0.21
61 0.2
62 0.23
63 0.28
64 0.3
65 0.37
66 0.46
67 0.5
68 0.55
69 0.64
70 0.72
71 0.77
72 0.82
73 0.82
74 0.77
75 0.7
76 0.65
77 0.59
78 0.56
79 0.53
80 0.47
81 0.41
82 0.35
83 0.31
84 0.27
85 0.22
86 0.14
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.05
99 0.06
100 0.06
101 0.09
102 0.09
103 0.1
104 0.11
105 0.12
106 0.12
107 0.11
108 0.1
109 0.08
110 0.08
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.03
122 0.04
123 0.11
124 0.15
125 0.19
126 0.2
127 0.22
128 0.27
129 0.33
130 0.4
131 0.36
132 0.33
133 0.37
134 0.42
135 0.45
136 0.43
137 0.39
138 0.35