Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QEK1

Protein Details
Accession A0A0C3QEK1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39IGEHLLWKRREKRRNPEGLPBasic
NLS Segment(s)
PositionSequence
29-32REKR
Subcellular Location(s) plas 11, extr 7, mito 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTLHGLVFAVWVIAVLLVIGEHLLWKRREKRRNPEGLPYPPGPRQLPFIGSVYNLLWCRVDVCAVSLLMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.03
10 0.05
11 0.1
12 0.12
13 0.2
14 0.3
15 0.4
16 0.5
17 0.58
18 0.68
19 0.73
20 0.81
21 0.77
22 0.76
23 0.74
24 0.69
25 0.64
26 0.55
27 0.49
28 0.41
29 0.42
30 0.34
31 0.28
32 0.28
33 0.25
34 0.24
35 0.23
36 0.22
37 0.18
38 0.17
39 0.18
40 0.14
41 0.17
42 0.16
43 0.15
44 0.14
45 0.13
46 0.14
47 0.13
48 0.14
49 0.1
50 0.11
51 0.13