Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QAU5

Protein Details
Accession A0A0C3QAU5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36LWKVPWRLSTPRKARQRQRLRGVGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences FRASPVSASGLLWKVPWRLSTPRKARQRQRLRGVGDVIDTVRQSGVQCEALTRALALPKEYEMPAKDKYTVFNRRLKGYRKGIHKVPKWTRLTLRENPQGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.23
5 0.31
6 0.39
7 0.48
8 0.54
9 0.61
10 0.7
11 0.78
12 0.83
13 0.84
14 0.87
15 0.87
16 0.87
17 0.85
18 0.78
19 0.73
20 0.65
21 0.54
22 0.44
23 0.34
24 0.25
25 0.18
26 0.14
27 0.1
28 0.08
29 0.08
30 0.07
31 0.07
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.12
49 0.12
50 0.15
51 0.18
52 0.19
53 0.21
54 0.2
55 0.24
56 0.31
57 0.39
58 0.4
59 0.44
60 0.46
61 0.5
62 0.57
63 0.59
64 0.6
65 0.61
66 0.62
67 0.64
68 0.68
69 0.7
70 0.72
71 0.73
72 0.75
73 0.74
74 0.77
75 0.73
76 0.73
77 0.73
78 0.72
79 0.73
80 0.71
81 0.71