Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L2C1

Protein Details
Accession A0A0C3L2C1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-109EGPPRFRDRQVCRQRHRPRRWSTCMMPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences NHLSKHLVQELKQKFKKDLSSKARAVRRLRTARESASLRLLEPPSKWTRCTRVSTSTPPYPCSFRGALPGPFPLEPQPRGEGPPRFRDRQVCRQRHRPRRWSTCMMPSANP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.65
4 0.63
5 0.64
6 0.62
7 0.66
8 0.69
9 0.72
10 0.73
11 0.7
12 0.69
13 0.66
14 0.67
15 0.67
16 0.66
17 0.64
18 0.62
19 0.56
20 0.57
21 0.52
22 0.43
23 0.4
24 0.35
25 0.29
26 0.29
27 0.28
28 0.23
29 0.21
30 0.25
31 0.27
32 0.28
33 0.3
34 0.3
35 0.35
36 0.38
37 0.43
38 0.42
39 0.41
40 0.44
41 0.48
42 0.5
43 0.49
44 0.45
45 0.41
46 0.39
47 0.34
48 0.31
49 0.29
50 0.24
51 0.19
52 0.23
53 0.25
54 0.25
55 0.23
56 0.24
57 0.21
58 0.2
59 0.21
60 0.21
61 0.23
62 0.22
63 0.23
64 0.25
65 0.24
66 0.27
67 0.33
68 0.36
69 0.36
70 0.45
71 0.49
72 0.5
73 0.52
74 0.59
75 0.61
76 0.64
77 0.7
78 0.7
79 0.72
80 0.79
81 0.87
82 0.88
83 0.9
84 0.9
85 0.89
86 0.9
87 0.9
88 0.88
89 0.84
90 0.83
91 0.79