Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3MFV1

Protein Details
Accession A0A0C3MFV1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-79VFKSQSSRSRCHRRHRRASRDRIFQQRKRPPBasic
NLS Segment(s)
PositionSequence
61-78RRHRRASRDRIFQQRKRP
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MTLSYAQRLSRRECQYCDRVLSDSKARSVHENSVHTFRLRFACWYCPKVFKSQSSRSRCHRRHRRASRDRIFQQRKRPPPGGPCPPTGDYPLCIAPADLFIVRPTVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.61
4 0.58
5 0.5
6 0.44
7 0.42
8 0.41
9 0.4
10 0.36
11 0.35
12 0.33
13 0.32
14 0.35
15 0.35
16 0.37
17 0.36
18 0.37
19 0.36
20 0.38
21 0.39
22 0.34
23 0.31
24 0.27
25 0.24
26 0.22
27 0.22
28 0.19
29 0.27
30 0.31
31 0.34
32 0.34
33 0.36
34 0.37
35 0.41
36 0.43
37 0.42
38 0.45
39 0.51
40 0.58
41 0.59
42 0.63
43 0.64
44 0.71
45 0.72
46 0.75
47 0.76
48 0.77
49 0.82
50 0.88
51 0.9
52 0.89
53 0.93
54 0.91
55 0.9
56 0.86
57 0.86
58 0.85
59 0.8
60 0.81
61 0.8
62 0.8
63 0.78
64 0.75
65 0.7
66 0.7
67 0.73
68 0.73
69 0.67
70 0.61
71 0.59
72 0.57
73 0.53
74 0.48
75 0.4
76 0.31
77 0.3
78 0.28
79 0.22
80 0.2
81 0.18
82 0.14
83 0.13
84 0.14
85 0.11
86 0.11
87 0.1