Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3LSR3

Protein Details
Accession A0A0C3LSR3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-40CPKVEPQEKKKKKTGRAYKRILYBasic
NLS Segment(s)
PositionSequence
25-37EKKKKKTGRAYKR
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEPQEKKKKKTGRAYKRILYNRRFVNVTTAPGAKRRMNPNPEGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.47
5 0.48
6 0.56
7 0.58
8 0.64
9 0.65
10 0.68
11 0.72
12 0.77
13 0.8
14 0.8
15 0.79
16 0.78
17 0.8
18 0.8
19 0.8
20 0.81
21 0.82
22 0.78
23 0.79
24 0.79
25 0.77
26 0.7
27 0.66
28 0.59
29 0.56
30 0.52
31 0.43
32 0.41
33 0.35
34 0.33
35 0.29
36 0.28
37 0.26
38 0.3
39 0.35
40 0.32
41 0.37
42 0.43
43 0.5
44 0.55
45 0.62
46 0.68