Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PRJ9

Protein Details
Accession A0A0C3PRJ9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
55-74MTEAKGKRLKKEKEIYRREKBasic
NLS Segment(s)
PositionSequence
59-74KGKRLKKEKEIYRREK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences AQIEDSYARRTMDPQRITAWKLAEEYGCSRLLVSMVAPIRNIDVQVKALESLMQMTEAKGKRLKKEKEIYRREK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.43
4 0.45
5 0.44
6 0.36
7 0.28
8 0.27
9 0.26
10 0.2
11 0.19
12 0.19
13 0.18
14 0.17
15 0.15
16 0.14
17 0.12
18 0.12
19 0.1
20 0.07
21 0.09
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.11
29 0.08
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.07
38 0.08
39 0.06
40 0.08
41 0.07
42 0.08
43 0.16
44 0.16
45 0.21
46 0.25
47 0.3
48 0.38
49 0.48
50 0.55
51 0.58
52 0.68
53 0.74
54 0.79