Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QFX5

Protein Details
Accession A0A0C3QFX5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRKYLCYTRRRGDRQFCPSSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MKRKYLCYTRRRGDRQFCPSSCSSSPQAFSSPSPADPLHRRRFNMRPSSGSDDGLCFRSGLPPPPEGSFEHLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.74
5 0.69
6 0.62
7 0.59
8 0.5
9 0.44
10 0.39
11 0.32
12 0.33
13 0.29
14 0.29
15 0.24
16 0.23
17 0.24
18 0.21
19 0.18
20 0.2
21 0.18
22 0.2
23 0.26
24 0.34
25 0.38
26 0.41
27 0.42
28 0.46
29 0.53
30 0.58
31 0.61
32 0.56
33 0.5
34 0.52
35 0.59
36 0.54
37 0.47
38 0.39
39 0.31
40 0.29
41 0.28
42 0.22
43 0.14
44 0.12
45 0.17
46 0.19
47 0.24
48 0.26
49 0.26
50 0.29
51 0.31
52 0.33
53 0.29