Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QTM5

Protein Details
Accession A0A0C3QTM5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
30-49QEARPSRSVQRCRSNPRQVQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MLTRAGFSPLASRFQTSSATSAKNVVQRQQEARPSRSVQRCRSNPRQVQQPDVRSTPML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.21
4 0.23
5 0.21
6 0.22
7 0.2
8 0.22
9 0.23
10 0.26
11 0.26
12 0.27
13 0.28
14 0.3
15 0.33
16 0.35
17 0.4
18 0.39
19 0.4
20 0.4
21 0.39
22 0.45
23 0.5
24 0.54
25 0.54
26 0.6
27 0.66
28 0.71
29 0.78
30 0.8
31 0.79
32 0.77
33 0.79
34 0.72
35 0.74
36 0.73
37 0.7
38 0.65
39 0.6