Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E3B4

Protein Details
Accession E9E3B4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
261-283QLDHGKKGRRARRVERLKPRFDTBasic
NLS Segment(s)
PositionSequence
265-279GKKGRRARRVERLKP
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, extr 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011044  Quino_amine_DH_bsu  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
KEGG maw:MAC_04362  -  
Amino Acid Sequences MSQQLLNDIESLEGTYLNSPVALSITPDGSKIAAAYRRFSLTIWSFDSATPLVRLARPEKASQPSKPLPFVSKISWHPGGDEILGIFISGHSFRWNIVDGAYQEHAPIPGQMPSDIICSPDGLVYAICGVRGTRRLFDYPSSMLIYQLNLDDLMTAFYFSHDGRKFDDIRGSYCAVWEPNALMRLRMVDDDAAHSQAAEQSSHAVCFGNDEGAVELFDYEASEKLRLGQTASQMSIEHLAWSEDGDRVCYAELGGRLTVVQLDHGKKGRRARRVERLKPRFDTMGVTQILFLPGSRNSLLVSSSSSVQRWSLEPAQLETTWDYWQSQTSRQWIPHPRYPPNLLSITPDGVSVHLRCSLEIISVLWDDVGKGDHPPGSLPESFINHTPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.09
9 0.08
10 0.09
11 0.1
12 0.13
13 0.13
14 0.14
15 0.14
16 0.13
17 0.13
18 0.12
19 0.16
20 0.2
21 0.22
22 0.24
23 0.27
24 0.29
25 0.3
26 0.29
27 0.32
28 0.29
29 0.32
30 0.32
31 0.31
32 0.3
33 0.29
34 0.32
35 0.24
36 0.22
37 0.18
38 0.16
39 0.16
40 0.17
41 0.22
42 0.22
43 0.3
44 0.31
45 0.34
46 0.4
47 0.47
48 0.51
49 0.5
50 0.55
51 0.55
52 0.57
53 0.57
54 0.53
55 0.49
56 0.47
57 0.47
58 0.42
59 0.41
60 0.4
61 0.43
62 0.44
63 0.39
64 0.36
65 0.34
66 0.31
67 0.24
68 0.21
69 0.14
70 0.1
71 0.1
72 0.08
73 0.06
74 0.05
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.11
82 0.13
83 0.12
84 0.12
85 0.15
86 0.14
87 0.18
88 0.18
89 0.16
90 0.15
91 0.15
92 0.15
93 0.11
94 0.12
95 0.09
96 0.11
97 0.12
98 0.12
99 0.12
100 0.12
101 0.14
102 0.13
103 0.13
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.07
110 0.07
111 0.06
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.08
118 0.15
119 0.17
120 0.18
121 0.21
122 0.23
123 0.25
124 0.27
125 0.28
126 0.24
127 0.24
128 0.23
129 0.2
130 0.19
131 0.17
132 0.16
133 0.12
134 0.11
135 0.09
136 0.06
137 0.06
138 0.05
139 0.05
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.07
146 0.07
147 0.15
148 0.16
149 0.17
150 0.19
151 0.24
152 0.25
153 0.25
154 0.3
155 0.23
156 0.24
157 0.26
158 0.25
159 0.2
160 0.19
161 0.19
162 0.14
163 0.13
164 0.11
165 0.09
166 0.09
167 0.12
168 0.12
169 0.11
170 0.11
171 0.11
172 0.11
173 0.11
174 0.09
175 0.07
176 0.07
177 0.1
178 0.1
179 0.1
180 0.09
181 0.08
182 0.08
183 0.09
184 0.1
185 0.07
186 0.06
187 0.08
188 0.09
189 0.09
190 0.09
191 0.08
192 0.07
193 0.08
194 0.09
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.04
203 0.04
204 0.04
205 0.03
206 0.04
207 0.05
208 0.06
209 0.06
210 0.06
211 0.09
212 0.1
213 0.1
214 0.12
215 0.13
216 0.16
217 0.17
218 0.18
219 0.16
220 0.15
221 0.15
222 0.16
223 0.13
224 0.1
225 0.08
226 0.08
227 0.07
228 0.08
229 0.08
230 0.08
231 0.08
232 0.09
233 0.09
234 0.09
235 0.09
236 0.08
237 0.08
238 0.08
239 0.09
240 0.09
241 0.09
242 0.09
243 0.08
244 0.08
245 0.09
246 0.07
247 0.08
248 0.12
249 0.15
250 0.19
251 0.24
252 0.28
253 0.32
254 0.42
255 0.47
256 0.51
257 0.58
258 0.63
259 0.69
260 0.77
261 0.82
262 0.84
263 0.85
264 0.84
265 0.78
266 0.73
267 0.64
268 0.54
269 0.48
270 0.39
271 0.38
272 0.3
273 0.27
274 0.23
275 0.21
276 0.21
277 0.16
278 0.14
279 0.09
280 0.09
281 0.13
282 0.13
283 0.12
284 0.12
285 0.13
286 0.13
287 0.12
288 0.13
289 0.11
290 0.14
291 0.15
292 0.15
293 0.16
294 0.16
295 0.17
296 0.16
297 0.21
298 0.23
299 0.24
300 0.25
301 0.27
302 0.29
303 0.28
304 0.28
305 0.24
306 0.21
307 0.18
308 0.18
309 0.17
310 0.14
311 0.2
312 0.2
313 0.25
314 0.29
315 0.34
316 0.38
317 0.4
318 0.49
319 0.53
320 0.58
321 0.6
322 0.63
323 0.63
324 0.65
325 0.68
326 0.62
327 0.58
328 0.53
329 0.46
330 0.43
331 0.39
332 0.34
333 0.28
334 0.26
335 0.2
336 0.19
337 0.22
338 0.17
339 0.16
340 0.19
341 0.19
342 0.19
343 0.21
344 0.2
345 0.17
346 0.17
347 0.16
348 0.13
349 0.13
350 0.14
351 0.11
352 0.11
353 0.09
354 0.09
355 0.11
356 0.08
357 0.1
358 0.13
359 0.15
360 0.15
361 0.17
362 0.2
363 0.23
364 0.23
365 0.24
366 0.26
367 0.29
368 0.31
369 0.35