Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DUM8

Protein Details
Accession E9DUM8    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKIKKDLIQKAKVHydrophilic
NLS Segment(s)
PositionSequence
16-61AKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIKA
121-185RRTRRPGYYDKQLKKAEERKKESEQKAQEIQRRTEERERRLAERERFRKAMAKTIGRDGKKKLGR
Subcellular Location(s) nucl 25
Family & Domain DBs
KEGG maw:MAC_01326  -  
Amino Acid Sequences MAPKRPLESGEPSSEAKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIKAREQQKDDNDDGVNPQDETPKSQEEGQEKMHPTRELMLKDEEKAQAGAGASADPTSDGMRRRTRRPGYYDKQLKKAEERKKESEQKAQEIQRRTEERERRLAERERFRKAMAKTIGRDGKKKLGRESTILLDKVKRIMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.44
4 0.48
5 0.5
6 0.56
7 0.64
8 0.69
9 0.72
10 0.73
11 0.78
12 0.74
13 0.74
14 0.68
15 0.62
16 0.53
17 0.48
18 0.42
19 0.37
20 0.37
21 0.38
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.73
30 0.74
31 0.81
32 0.82
33 0.8
34 0.78
35 0.75
36 0.75
37 0.77
38 0.76
39 0.71
40 0.67
41 0.67
42 0.67
43 0.69
44 0.69
45 0.65
46 0.68
47 0.7
48 0.72
49 0.71
50 0.66
51 0.66
52 0.62
53 0.64
54 0.57
55 0.53
56 0.44
57 0.36
58 0.32
59 0.25
60 0.19
61 0.14
62 0.13
63 0.14
64 0.14
65 0.17
66 0.19
67 0.18
68 0.19
69 0.2
70 0.24
71 0.22
72 0.25
73 0.25
74 0.28
75 0.28
76 0.29
77 0.31
78 0.27
79 0.24
80 0.26
81 0.26
82 0.22
83 0.22
84 0.25
85 0.22
86 0.22
87 0.25
88 0.21
89 0.17
90 0.16
91 0.13
92 0.1
93 0.09
94 0.09
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.03
101 0.04
102 0.05
103 0.07
104 0.1
105 0.16
106 0.25
107 0.3
108 0.35
109 0.45
110 0.51
111 0.55
112 0.61
113 0.65
114 0.63
115 0.7
116 0.75
117 0.7
118 0.71
119 0.68
120 0.63
121 0.62
122 0.65
123 0.64
124 0.64
125 0.67
126 0.65
127 0.71
128 0.78
129 0.74
130 0.74
131 0.7
132 0.66
133 0.67
134 0.67
135 0.64
136 0.6
137 0.58
138 0.57
139 0.56
140 0.56
141 0.58
142 0.59
143 0.58
144 0.62
145 0.63
146 0.58
147 0.62
148 0.64
149 0.64
150 0.66
151 0.67
152 0.65
153 0.63
154 0.61
155 0.61
156 0.54
157 0.54
158 0.52
159 0.52
160 0.48
161 0.55
162 0.61
163 0.58
164 0.61
165 0.57
166 0.58
167 0.57
168 0.6
169 0.59
170 0.61
171 0.6
172 0.6
173 0.59
174 0.57
175 0.58
176 0.54
177 0.48
178 0.42
179 0.4
180 0.4