Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q458

Protein Details
Accession A0A0C3Q458   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
87-111DEDPAASKKKKKPTKAQLEKEKAKABasic
187-214SGKDPFKKPPAAKKRKPVDKRQVVNFEDHydrophilic
NLS Segment(s)
PositionSequence
93-119SKKKKKPTKAQLEKEKAKAAAAKKRKR
189-205KDPFKKPPAAKKRKPVD
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
Amino Acid Sequences MSRRRVGANGITGPSSALTAFLRDQGISTRPTNTWRRRVETEGDDAEVGPSNAEAGPSNTEAGPSNSNPSPSRANQDGYNSDNLDDDEDPAASKKKKKPTKAQLEKEKAKAAAAKKRKRADDDSDYDDEEDSYNKPSAVNGAALGAPPDIGSFENCAECGKRFTVTKYTMAKHPPPGYLCHLCAKASGKDPFKKPPAAKKRKPVDKRQVVNFEDTESVKTLANICIEIISNHIDDVDALGDCMQKHYFVLIAFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.13
4 0.1
5 0.09
6 0.11
7 0.12
8 0.14
9 0.15
10 0.14
11 0.15
12 0.17
13 0.19
14 0.21
15 0.22
16 0.23
17 0.23
18 0.31
19 0.41
20 0.46
21 0.53
22 0.57
23 0.62
24 0.63
25 0.67
26 0.67
27 0.61
28 0.58
29 0.5
30 0.44
31 0.37
32 0.32
33 0.27
34 0.21
35 0.16
36 0.1
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.11
44 0.11
45 0.13
46 0.12
47 0.13
48 0.13
49 0.15
50 0.17
51 0.15
52 0.19
53 0.19
54 0.23
55 0.23
56 0.25
57 0.29
58 0.27
59 0.33
60 0.31
61 0.32
62 0.31
63 0.35
64 0.35
65 0.32
66 0.33
67 0.27
68 0.24
69 0.22
70 0.2
71 0.17
72 0.14
73 0.12
74 0.1
75 0.09
76 0.09
77 0.1
78 0.15
79 0.16
80 0.24
81 0.29
82 0.39
83 0.48
84 0.57
85 0.66
86 0.72
87 0.8
88 0.83
89 0.86
90 0.87
91 0.88
92 0.85
93 0.77
94 0.69
95 0.58
96 0.48
97 0.43
98 0.38
99 0.38
100 0.43
101 0.47
102 0.52
103 0.57
104 0.6
105 0.61
106 0.62
107 0.6
108 0.58
109 0.55
110 0.52
111 0.47
112 0.44
113 0.38
114 0.32
115 0.24
116 0.16
117 0.12
118 0.07
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.1
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.06
140 0.07
141 0.07
142 0.08
143 0.09
144 0.09
145 0.1
146 0.12
147 0.11
148 0.13
149 0.14
150 0.17
151 0.24
152 0.26
153 0.33
154 0.36
155 0.37
156 0.4
157 0.45
158 0.46
159 0.45
160 0.45
161 0.42
162 0.38
163 0.4
164 0.42
165 0.39
166 0.38
167 0.35
168 0.33
169 0.29
170 0.31
171 0.31
172 0.28
173 0.3
174 0.35
175 0.38
176 0.44
177 0.48
178 0.53
179 0.55
180 0.6
181 0.59
182 0.63
183 0.67
184 0.71
185 0.76
186 0.77
187 0.82
188 0.85
189 0.88
190 0.88
191 0.88
192 0.88
193 0.87
194 0.86
195 0.84
196 0.76
197 0.72
198 0.61
199 0.52
200 0.45
201 0.38
202 0.3
203 0.23
204 0.22
205 0.17
206 0.18
207 0.17
208 0.17
209 0.17
210 0.16
211 0.14
212 0.14
213 0.14
214 0.13
215 0.13
216 0.13
217 0.12
218 0.11
219 0.11
220 0.1
221 0.09
222 0.1
223 0.1
224 0.07
225 0.07
226 0.08
227 0.1
228 0.1
229 0.14
230 0.13
231 0.12
232 0.13
233 0.13
234 0.15