Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3M633

Protein Details
Accession A0A0C3M633    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-123ASNKYGARPKRFRSKVKYFFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036537  Adaptor_Cbl_N_dom_sf  
Gene Ontology GO:0007166  P:cell surface receptor signaling pathway  
CDD cd21037  MLKL_NTD  
Amino Acid Sequences MNSQSSGTQPPTNPPPESHHLARPALISDKVDAARGAVLAILQDTTWPRRSTNTALGLADMIGDAQNLKNIPKDETQIPAEHRSSLEHLLNIMESAQRKLQEASNKYGARPKRFRSKVKYFFTYLDRNECTEILEACQNDITDALVALPNRWSHQVAPGDSSDRSTNFDMQAIPQPTPVAHPAESADNPGVSATNSTSSIASSQIPPAPMPAKNQQPAVPEGNATGPSKRKKPLSAIKTTLDIVEAASGTFPIVGSYVGAAAKVGNIIVQMVQKMDSNEETAKDLEDHASRLSEILDTARDESVQKQKERMTACMNDVQKELQSLQVKLEEMNGLGRANKVFFSRDHDETMKGYKEKIRSALEAMQVRDLHLARATLAHLSASRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.5
4 0.56
5 0.53
6 0.52
7 0.52
8 0.51
9 0.49
10 0.43
11 0.39
12 0.35
13 0.33
14 0.27
15 0.22
16 0.26
17 0.25
18 0.24
19 0.21
20 0.18
21 0.17
22 0.15
23 0.13
24 0.08
25 0.08
26 0.07
27 0.07
28 0.06
29 0.05
30 0.08
31 0.11
32 0.16
33 0.22
34 0.23
35 0.24
36 0.28
37 0.35
38 0.39
39 0.44
40 0.45
41 0.43
42 0.42
43 0.41
44 0.37
45 0.3
46 0.24
47 0.15
48 0.09
49 0.05
50 0.05
51 0.05
52 0.05
53 0.08
54 0.09
55 0.1
56 0.14
57 0.16
58 0.2
59 0.22
60 0.26
61 0.26
62 0.3
63 0.32
64 0.32
65 0.35
66 0.37
67 0.35
68 0.32
69 0.31
70 0.28
71 0.29
72 0.29
73 0.27
74 0.21
75 0.2
76 0.19
77 0.18
78 0.16
79 0.13
80 0.11
81 0.1
82 0.12
83 0.14
84 0.15
85 0.16
86 0.18
87 0.22
88 0.28
89 0.31
90 0.35
91 0.42
92 0.42
93 0.41
94 0.47
95 0.49
96 0.5
97 0.54
98 0.55
99 0.57
100 0.65
101 0.73
102 0.76
103 0.8
104 0.8
105 0.79
106 0.78
107 0.69
108 0.65
109 0.61
110 0.59
111 0.5
112 0.47
113 0.41
114 0.37
115 0.36
116 0.32
117 0.28
118 0.22
119 0.2
120 0.14
121 0.15
122 0.14
123 0.13
124 0.14
125 0.12
126 0.1
127 0.1
128 0.08
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.09
136 0.09
137 0.1
138 0.12
139 0.13
140 0.12
141 0.19
142 0.23
143 0.21
144 0.23
145 0.23
146 0.23
147 0.22
148 0.23
149 0.18
150 0.14
151 0.17
152 0.16
153 0.17
154 0.15
155 0.16
156 0.15
157 0.15
158 0.21
159 0.19
160 0.18
161 0.16
162 0.16
163 0.15
164 0.16
165 0.16
166 0.12
167 0.11
168 0.11
169 0.12
170 0.14
171 0.14
172 0.14
173 0.12
174 0.09
175 0.09
176 0.09
177 0.08
178 0.05
179 0.06
180 0.05
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.07
187 0.08
188 0.08
189 0.08
190 0.09
191 0.1
192 0.11
193 0.11
194 0.12
195 0.14
196 0.14
197 0.18
198 0.22
199 0.27
200 0.28
201 0.3
202 0.31
203 0.3
204 0.33
205 0.31
206 0.26
207 0.2
208 0.18
209 0.18
210 0.18
211 0.16
212 0.15
213 0.19
214 0.23
215 0.28
216 0.32
217 0.35
218 0.36
219 0.45
220 0.52
221 0.54
222 0.58
223 0.57
224 0.54
225 0.52
226 0.48
227 0.39
228 0.29
229 0.21
230 0.13
231 0.09
232 0.08
233 0.05
234 0.05
235 0.05
236 0.04
237 0.04
238 0.04
239 0.03
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.04
249 0.05
250 0.05
251 0.04
252 0.04
253 0.04
254 0.04
255 0.06
256 0.07
257 0.07
258 0.07
259 0.08
260 0.1
261 0.1
262 0.12
263 0.12
264 0.14
265 0.15
266 0.15
267 0.16
268 0.15
269 0.15
270 0.14
271 0.14
272 0.14
273 0.14
274 0.14
275 0.13
276 0.13
277 0.13
278 0.12
279 0.12
280 0.09
281 0.08
282 0.09
283 0.09
284 0.1
285 0.12
286 0.12
287 0.12
288 0.13
289 0.18
290 0.26
291 0.31
292 0.32
293 0.35
294 0.39
295 0.45
296 0.47
297 0.46
298 0.44
299 0.42
300 0.43
301 0.46
302 0.43
303 0.39
304 0.37
305 0.34
306 0.27
307 0.26
308 0.23
309 0.23
310 0.25
311 0.23
312 0.25
313 0.26
314 0.26
315 0.24
316 0.25
317 0.19
318 0.15
319 0.17
320 0.15
321 0.13
322 0.14
323 0.15
324 0.14
325 0.15
326 0.16
327 0.16
328 0.17
329 0.18
330 0.25
331 0.3
332 0.31
333 0.36
334 0.36
335 0.36
336 0.37
337 0.42
338 0.4
339 0.35
340 0.36
341 0.37
342 0.41
343 0.44
344 0.48
345 0.47
346 0.44
347 0.48
348 0.5
349 0.51
350 0.5
351 0.46
352 0.45
353 0.4
354 0.38
355 0.38
356 0.33
357 0.27
358 0.24
359 0.23
360 0.18
361 0.19
362 0.19
363 0.15
364 0.15
365 0.15