Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LW24

Protein Details
Accession A0A0C3LW24   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-111DVAERKKRGKGAPKKAKSPEESRRLAKKKRKBasic
NLS Segment(s)
PositionSequence
85-111RKKRGKGAPKKAKSPEESRRLAKKKRK
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSALLTCARSRLLELTRLRCDIFSTLYNPLGLRTGAKYLRARLRGPSMVQYYPKQLSFKELSRAMPELKLVNFEEEQRLFDVAERKKRGKGAPKKAKSPEESRRLAKKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.43
4 0.45
5 0.43
6 0.37
7 0.36
8 0.3
9 0.27
10 0.22
11 0.2
12 0.22
13 0.22
14 0.22
15 0.2
16 0.18
17 0.16
18 0.14
19 0.12
20 0.11
21 0.15
22 0.16
23 0.21
24 0.23
25 0.28
26 0.35
27 0.37
28 0.37
29 0.36
30 0.4
31 0.37
32 0.36
33 0.36
34 0.32
35 0.3
36 0.32
37 0.29
38 0.28
39 0.27
40 0.28
41 0.23
42 0.19
43 0.22
44 0.23
45 0.24
46 0.25
47 0.25
48 0.24
49 0.26
50 0.28
51 0.23
52 0.2
53 0.19
54 0.16
55 0.14
56 0.16
57 0.14
58 0.15
59 0.15
60 0.16
61 0.19
62 0.17
63 0.18
64 0.16
65 0.16
66 0.14
67 0.16
68 0.23
69 0.25
70 0.34
71 0.39
72 0.41
73 0.44
74 0.51
75 0.56
76 0.59
77 0.63
78 0.65
79 0.71
80 0.76
81 0.81
82 0.84
83 0.84
84 0.8
85 0.8
86 0.78
87 0.76
88 0.76
89 0.74
90 0.77
91 0.78