Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QPP3

Protein Details
Accession A0A0C3QPP3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-44ACNKGFKRSDARQRHWKQYLHydrophilic
NLS Segment(s)
PositionSequence
63-70KRRRSTKS
Subcellular Location(s) extr 9, cyto_nucl 7.333, cyto 6.5, cyto_mito 6.166, nucl 6, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MFARPHDLRRHANIHTDILPFTCLACNKGFKRSDARQRHWKQYLDCKDLHMALEERGFDGGGKRRRSTKSQGRKAAENDFVTRRGSSIALPIAETNSSVPRTSLLGPFLNSLTRRASSTPLPDVPFPFGSSFSILTPFVTSAPEPSLGLFAGTDNPLFLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.35
5 0.3
6 0.28
7 0.19
8 0.17
9 0.17
10 0.14
11 0.15
12 0.18
13 0.26
14 0.27
15 0.36
16 0.37
17 0.37
18 0.45
19 0.52
20 0.59
21 0.61
22 0.67
23 0.7
24 0.75
25 0.81
26 0.79
27 0.76
28 0.71
29 0.71
30 0.73
31 0.67
32 0.6
33 0.52
34 0.48
35 0.43
36 0.37
37 0.29
38 0.2
39 0.16
40 0.18
41 0.15
42 0.13
43 0.12
44 0.12
45 0.09
46 0.11
47 0.18
48 0.23
49 0.27
50 0.28
51 0.35
52 0.39
53 0.44
54 0.51
55 0.54
56 0.58
57 0.64
58 0.71
59 0.68
60 0.68
61 0.66
62 0.61
63 0.55
64 0.46
65 0.39
66 0.32
67 0.3
68 0.26
69 0.23
70 0.18
71 0.13
72 0.12
73 0.1
74 0.1
75 0.11
76 0.1
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.07
83 0.09
84 0.1
85 0.09
86 0.09
87 0.09
88 0.12
89 0.13
90 0.14
91 0.15
92 0.15
93 0.16
94 0.17
95 0.16
96 0.18
97 0.17
98 0.17
99 0.17
100 0.16
101 0.17
102 0.18
103 0.21
104 0.21
105 0.26
106 0.29
107 0.3
108 0.31
109 0.31
110 0.32
111 0.33
112 0.3
113 0.26
114 0.22
115 0.19
116 0.18
117 0.19
118 0.18
119 0.14
120 0.16
121 0.14
122 0.14
123 0.14
124 0.13
125 0.11
126 0.13
127 0.12
128 0.12
129 0.14
130 0.14
131 0.13
132 0.13
133 0.14
134 0.12
135 0.12
136 0.1
137 0.09
138 0.1
139 0.11
140 0.11
141 0.1