Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PYT0

Protein Details
Accession A0A0C3PYT0   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-51STYFNDAQRRPPRRRSDHPPCHQQTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR018181  Heat_shock_70_CS  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00012  HSP70  
PROSITE View protein in PROSITE  
PS00329  HSP70_2  
Amino Acid Sequences MVLGKMKQIAEAYLREKVPPALVTVSTYFNDAQRRPPRRRSDHPPCHQQTHHRPIPYALDKKNSRGADEFYIIVYDLGGGTFGVSLLTIDDGVFEVLATAGFQAQAQEGPLLKRRSPSSETARERAKLPPAMTLAPVHSFLNRARPSLLPPSAMYRTTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.28
4 0.27
5 0.27
6 0.22
7 0.22
8 0.18
9 0.18
10 0.2
11 0.21
12 0.22
13 0.19
14 0.2
15 0.18
16 0.19
17 0.25
18 0.24
19 0.32
20 0.39
21 0.48
22 0.54
23 0.63
24 0.7
25 0.72
26 0.8
27 0.81
28 0.82
29 0.84
30 0.85
31 0.86
32 0.81
33 0.78
34 0.73
35 0.72
36 0.71
37 0.7
38 0.67
39 0.57
40 0.53
41 0.48
42 0.53
43 0.51
44 0.48
45 0.4
46 0.44
47 0.44
48 0.46
49 0.52
50 0.44
51 0.38
52 0.33
53 0.33
54 0.27
55 0.27
56 0.24
57 0.16
58 0.16
59 0.13
60 0.11
61 0.08
62 0.05
63 0.03
64 0.03
65 0.03
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.07
96 0.09
97 0.17
98 0.2
99 0.2
100 0.25
101 0.27
102 0.32
103 0.35
104 0.41
105 0.42
106 0.5
107 0.54
108 0.55
109 0.58
110 0.53
111 0.51
112 0.48
113 0.46
114 0.41
115 0.36
116 0.36
117 0.34
118 0.34
119 0.33
120 0.3
121 0.25
122 0.22
123 0.23
124 0.18
125 0.16
126 0.18
127 0.18
128 0.27
129 0.26
130 0.26
131 0.27
132 0.27
133 0.32
134 0.39
135 0.39
136 0.32
137 0.32
138 0.37
139 0.39
140 0.38