Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QPF9

Protein Details
Accession A0A0C3QPF9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-118SSGQPKEKKAKQEKKGKKEGABasic
NLS Segment(s)
PositionSequence
101-120QPKEKKAKQEKKGKKEGAAA
Subcellular Location(s) mito 19.5, cyto_mito 13.333, cyto 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
Amino Acid Sequences MLRALLRPPTTRALSSNDLVKSTFVGNGQLAGSGSEADTKPVDEWIDKISGGSLVAQSGSLKKKAKKDTVADAKSETAVDSKSAVSGSVRVKAQASGSSGQPKEKKAKQEKKGKKEGAAATAAGEASGKRAAGGAAAPAADAGEPSPAMIDLRVGHIVDNGLYVEEIDLGEETGPRTIISGLVNYIPIEKMQDKWLIVVRCRIVLTQVHWASHKDGKDKGIEIVDPPKGCKSGDRIYFEGEKYESKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.42
4 0.36
5 0.34
6 0.32
7 0.29
8 0.24
9 0.2
10 0.2
11 0.14
12 0.15
13 0.14
14 0.15
15 0.15
16 0.14
17 0.13
18 0.11
19 0.1
20 0.08
21 0.08
22 0.11
23 0.11
24 0.12
25 0.12
26 0.13
27 0.13
28 0.14
29 0.16
30 0.12
31 0.13
32 0.14
33 0.15
34 0.14
35 0.14
36 0.12
37 0.11
38 0.11
39 0.1
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.12
46 0.15
47 0.21
48 0.27
49 0.32
50 0.41
51 0.49
52 0.57
53 0.6
54 0.62
55 0.66
56 0.71
57 0.68
58 0.6
59 0.53
60 0.45
61 0.38
62 0.33
63 0.22
64 0.13
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.12
74 0.13
75 0.16
76 0.16
77 0.16
78 0.17
79 0.18
80 0.18
81 0.16
82 0.17
83 0.14
84 0.16
85 0.22
86 0.22
87 0.27
88 0.28
89 0.3
90 0.35
91 0.38
92 0.46
93 0.51
94 0.6
95 0.64
96 0.73
97 0.79
98 0.8
99 0.86
100 0.79
101 0.71
102 0.69
103 0.62
104 0.54
105 0.45
106 0.35
107 0.26
108 0.23
109 0.18
110 0.11
111 0.08
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.05
163 0.06
164 0.06
165 0.08
166 0.08
167 0.08
168 0.09
169 0.09
170 0.1
171 0.1
172 0.1
173 0.09
174 0.08
175 0.12
176 0.12
177 0.13
178 0.16
179 0.2
180 0.19
181 0.22
182 0.28
183 0.28
184 0.29
185 0.33
186 0.31
187 0.29
188 0.3
189 0.28
190 0.25
191 0.24
192 0.25
193 0.29
194 0.3
195 0.29
196 0.3
197 0.32
198 0.33
199 0.35
200 0.36
201 0.31
202 0.32
203 0.34
204 0.37
205 0.37
206 0.35
207 0.33
208 0.3
209 0.29
210 0.31
211 0.34
212 0.3
213 0.31
214 0.31
215 0.3
216 0.29
217 0.31
218 0.32
219 0.36
220 0.43
221 0.47
222 0.45
223 0.49
224 0.54
225 0.5
226 0.46
227 0.39