Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3KJ15

Protein Details
Accession A0A0C3KJ15    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25SGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
4-19KAAKKKKWSKGKVKDK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SGGKAAKKKKWSKGKVKDKAQHAVALDKNLYDRIMKEVPTFRFISVSILIERLKINGSLARKAIQHLKKEGTIKCVVHHSAQRIYSESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.92
4 0.9
5 0.85
6 0.83
7 0.73
8 0.66
9 0.56
10 0.52
11 0.43
12 0.38
13 0.31
14 0.24
15 0.22
16 0.19
17 0.18
18 0.12
19 0.11
20 0.14
21 0.15
22 0.16
23 0.18
24 0.23
25 0.24
26 0.27
27 0.27
28 0.22
29 0.21
30 0.2
31 0.2
32 0.15
33 0.14
34 0.11
35 0.12
36 0.11
37 0.12
38 0.12
39 0.1
40 0.09
41 0.08
42 0.09
43 0.11
44 0.14
45 0.15
46 0.17
47 0.18
48 0.18
49 0.21
50 0.29
51 0.32
52 0.35
53 0.38
54 0.4
55 0.43
56 0.49
57 0.49
58 0.46
59 0.46
60 0.41
61 0.39
62 0.42
63 0.39
64 0.38
65 0.41
66 0.4
67 0.4
68 0.42
69 0.42