Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EAA7

Protein Details
Accession E9EAA7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-104RELWSKGKLVRKWKRCCDQWCEVKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 17, nucl 12.5, cyto 12.5
Family & Domain DBs
KEGG maw:MAC_06806  -  
Amino Acid Sequences MTDITRQIFFYFDVGDIETAKSFIIKAWDWLRREKVVSEETHSEAQRKLEICDAAPQETDEQIYKVVQSEGGVFVGKDCRELWSKGKLVRKWKRCCDQWCEVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.11
6 0.1
7 0.09
8 0.08
9 0.07
10 0.08
11 0.11
12 0.11
13 0.16
14 0.22
15 0.29
16 0.31
17 0.37
18 0.4
19 0.38
20 0.39
21 0.35
22 0.33
23 0.31
24 0.31
25 0.29
26 0.28
27 0.28
28 0.3
29 0.29
30 0.26
31 0.23
32 0.22
33 0.21
34 0.19
35 0.17
36 0.16
37 0.16
38 0.15
39 0.19
40 0.19
41 0.16
42 0.15
43 0.15
44 0.13
45 0.12
46 0.13
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.12
63 0.12
64 0.12
65 0.12
66 0.14
67 0.18
68 0.22
69 0.25
70 0.29
71 0.34
72 0.39
73 0.47
74 0.5
75 0.58
76 0.65
77 0.71
78 0.73
79 0.79
80 0.83
81 0.83
82 0.86
83 0.83
84 0.83