Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DVE3

Protein Details
Accession E9DVE3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
143-167AQAPVDKKVKKKAKKIKLSFDEDEGHydrophilic
NLS Segment(s)
PositionSequence
112-115RKRK
149-159KKVKKKAKKIK
Subcellular Location(s) cyto_nucl 14.333, nucl 14, mito_nucl 9.665, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG maw:MAC_01591  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPEKITSKNLSYNASLPPFLARLHAQSAGAAGPDPLLAAQKRSAKKRSDSEEAEDAPLVVDEHGNAVDLQLEKDGTVKGTETKSGQDETGGAELDEKAVKRDAAATASIGARKRKVGKVIGERASHGSGNDGKDQQEDKLGGAQAPVDKKVKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.27
4 0.26
5 0.24
6 0.21
7 0.22
8 0.17
9 0.17
10 0.2
11 0.21
12 0.19
13 0.18
14 0.19
15 0.15
16 0.14
17 0.11
18 0.07
19 0.06
20 0.06
21 0.05
22 0.05
23 0.08
24 0.08
25 0.1
26 0.16
27 0.23
28 0.29
29 0.37
30 0.44
31 0.46
32 0.53
33 0.6
34 0.62
35 0.62
36 0.6
37 0.58
38 0.56
39 0.51
40 0.45
41 0.36
42 0.29
43 0.2
44 0.17
45 0.12
46 0.06
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.06
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.09
66 0.09
67 0.11
68 0.11
69 0.12
70 0.13
71 0.14
72 0.13
73 0.1
74 0.1
75 0.1
76 0.1
77 0.08
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.07
84 0.07
85 0.08
86 0.08
87 0.08
88 0.1
89 0.1
90 0.1
91 0.11
92 0.1
93 0.1
94 0.11
95 0.14
96 0.15
97 0.17
98 0.17
99 0.21
100 0.27
101 0.29
102 0.35
103 0.38
104 0.43
105 0.51
106 0.58
107 0.59
108 0.55
109 0.52
110 0.5
111 0.46
112 0.38
113 0.28
114 0.23
115 0.21
116 0.22
117 0.25
118 0.23
119 0.22
120 0.25
121 0.26
122 0.23
123 0.24
124 0.22
125 0.19
126 0.22
127 0.22
128 0.18
129 0.17
130 0.19
131 0.18
132 0.2
133 0.23
134 0.25
135 0.28
136 0.34
137 0.44
138 0.53
139 0.58
140 0.67
141 0.74
142 0.79
143 0.86
144 0.9
145 0.9
146 0.89
147 0.88