Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QAJ9

Protein Details
Accession A0A0C3QAJ9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-95EVKVSRPQKRRTYPAKPHQNRRRCNDPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MADQRQNQAFQTAHLRPISLRQTAMAFARFRERYAELQALSDGGLKITEIRAEEEATFTIIVARAAAEVKVSRPQKRRTYPAKPHQNRRRCNDPSAEQSIPDPLTPAPRSEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.33
5 0.36
6 0.29
7 0.27
8 0.23
9 0.24
10 0.26
11 0.28
12 0.24
13 0.19
14 0.18
15 0.26
16 0.25
17 0.25
18 0.27
19 0.27
20 0.26
21 0.3
22 0.32
23 0.24
24 0.24
25 0.23
26 0.19
27 0.17
28 0.15
29 0.1
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.06
37 0.07
38 0.08
39 0.09
40 0.09
41 0.1
42 0.09
43 0.09
44 0.08
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.07
57 0.14
58 0.19
59 0.27
60 0.34
61 0.43
62 0.52
63 0.6
64 0.68
65 0.7
66 0.77
67 0.8
68 0.83
69 0.86
70 0.85
71 0.88
72 0.89
73 0.89
74 0.87
75 0.84
76 0.84
77 0.77
78 0.75
79 0.72
80 0.68
81 0.66
82 0.65
83 0.58
84 0.48
85 0.44
86 0.42
87 0.35
88 0.28
89 0.22
90 0.16
91 0.23
92 0.24
93 0.25